SecReT4
Protein ID: 51473489
T4SS name [ID]VirB [498]
Gene symbolvirD4
Locus tagRT0284
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]357721..359496 [+]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDQ8GLV7, Q68X78
KEGG IDrty:RT0284
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.9e-168, Aligned region: 120..567
TraG-D_C [PF12696], Evalue: 2.1e-28, Aligned region: 404..526
TrwB_AAD_bind [PF10412], Evalue: 2e-21, Aligned region: 237..535
AAA_10 [PF12846], Evalue: 4.9e-05, Aligned region: 306..481
Protein Sequence: 591 a.a.     [Download]
>gi|51473489|ref|YP_067246.1| type IV secretion system component VirD4 [Rickettsia typhi str. Wilmington]
MEWHKILKVTRNIFGHAIIHPVVIFCTIWISGVFIAIFTNEIGALGADINAINITYKWAYWLINVWRQLK
IADYNYLKLKLIISLLGPAIIVIIFYIKNFQRIKSLQFFEQPEKVYGDASWANQSDIEAAGLRSKKGMLI
GVDAGGYFVADGFQHALLFAPTGSGKGVGFVIPNLLFWTDSVVVHDIKLENHNLTSGWREKQGQKVFVWE
PSNPDGITHCYNPIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPTKTKSFGEV
VRTMRSDDVVYNLAVVLDTLGGVIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANPLIDSATASSD
FNIQEFKKVKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKEEPYGVMFLLDEFPTLGKMDTF
KAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLSNSTYRITFAANNYETANLISQLVGNKTVEQRS
FSKPLFFDLNISTRTQNVSQVQRALLLPQEVIQLPRDEQIVLIESFPPIKSRKIKYYEDKFFTSRLLPPT
FVPTQVPFNHVSNNSDASKETETTTAIENNE
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|51473215|ref|NC_006142.1|:357721-359496 Rickettsia typhi str. Wilmington, complete genome
ATGGAATGGCATAAGATACTTAAAGTTACTAGGAATATATTCGGTCATGCTATAATTCATCCGGTTGTTA
TTTTTTGCACCATTTGGATCAGTGGTGTGTTTATTGCAATTTTTACTAATGAGATCGGAGCTTTAGGTGC
AGACATCAATGCTATAAATATTACTTATAAGTGGGCTTACTGGCTTATTAATGTTTGGCGGCAATTAAAA
ATTGCCGATTATAATTATTTGAAATTGAAGCTAATTATATCTCTTCTTGGTCCTGCTATTATTGTTATAA
TATTTTATATTAAAAATTTTCAAAGAATAAAATCATTACAATTTTTTGAGCAGCCTGAAAAAGTATATGG
TGACGCTAGTTGGGCTAATCAGTCTGATATAGAAGCTGCTGGTCTTAGATCAAAAAAAGGCATGTTAATA
GGTGTTGATGCTGGTGGATATTTTGTTGCAGATGGGTTTCAGCATGCTTTATTATTCGCACCTACCGGTT
CAGGTAAAGGTGTTGGTTTTGTAATACCTAACCTTTTATTTTGGACTGATTCAGTAGTAGTACATGATAT
AAAGCTTGAAAATCACAATTTGACTAGTGGTTGGCGTGAGAAACAAGGGCAAAAAGTTTTTGTTTGGGAA
CCTTCTAATCCAGATGGTATTACACATTGTTATAATCCGATTGATTGGGTTAGTACTAAGCCTGGGCAAA
TGGTTGATGATGTACAGAAAATTTCGAATCTTATAATGCCAGAAAAGGATTTTTGGAACAATGAAGCACG
TAGTTTATTCTTAGGCGTAACTTTATATTTAATAGCTGATCCTACTAAAACTAAATCTTTCGGTGAAGTA
GTACGTACAATGAGAAGTGACGATGTAGTTTATAATCTAGCCGTTGTACTTGATACGCTTGGTGGTGTAA
TACATCCTGTTGCATATATGAATATTGCTGCATTTTTGCAAAAAGCTGATAAAGAGCGTTCCGGTGTAAT
ATCTACAATGAATTCATCACTTGAATTATGGGCAAATCCACTTATTGATTCTGCTACTGCATCTTCTGAC
TTCAATATACAAGAATTTAAAAAAGTTAAAACAACAGTGTATGTAGGATTAACACCTGATAATATACAGC
GTTTGCAAAAATTAATGCAGGTATTTTATCAGCAGGCTACAGAATTTTTAAGCCGTAAAATGCCTGATTT
AAAGGAGGAACCATATGGAGTAATGTTCTTACTTGATGAGTTCCCGACTCTTGGAAAGATGGATACTTTT
AAAGCTGGTATCGCTTATTTTAGAGGTTATAGAGTTCGGTTATTTTTGATTATCCAAGATACGCAGCAAT
TAAAAGGAACATATGAGGACGCCGGTATGAATTCTTTCTTATCTAATTCCACATATCGCATTACCTTTGC
TGCTAATAACTATGAAACTGCAAATTTAATATCGCAGCTTGTTGGTAATAAGACTGTAGAACAAAGGTCA
TTTAGTAAACCTTTATTTTTTGACCTTAATATTTCTACTAGAACCCAAAATGTATCTCAAGTTCAAAGAG
CTTTACTTTTACCTCAAGAAGTAATACAGTTACCGCGAGATGAGCAAATTGTTTTAATTGAATCCTTCCC
GCCTATAAAATCTCGTAAAATTAAGTATTACGAAGATAAGTTTTTTACTAGTAGATTATTACCGCCGACT
TTTGTACCTACTCAAGTACCCTTTAATCATGTGTCAAATAATAGTGATGCTTCTAAAGAGACTGAAACAA
CAACTGCTATCGAAAATAATGAGTAA
 Primer design