SecReT4
Protein ID: 51473952
T4SS name [ID]VirB [498]
Gene symbolvirB4b
Locus tagRT0771
StrainRickettsia typhi str. Wilmington
Repliconchromosome [GenBank: NC_006142] [Browse all T4SS(s) in this replicon]
Location [Strand]982177..984609 [+]
ProductVirB4 protein precursor
Component typeVirB4
UniProt IDQ68VW5
KEGG IDrty:RT0771
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 3.9e-51, Aligned region: 183..383
AAA_10 [PF12846], Evalue: 3.5e-08, Aligned region: 436..612
Protein Sequence: 810 a.a.     [Download]
>gi|51473952|ref|YP_067709.1| VirB4 protein precursor [Rickettsia typhi str. Wilmington]
MFSDLRKFDKDIYNYNAPNFIPIACHYNENTLLTKDGKLLQIVKIHGINSEKISDNIQNLREMVRLAIKK
HITDYDFAFWLHTIREKQNLDDTTPYKKLLPANIHTLWQRKNHWNDKFVNTLYISIIHDSAKIQIKNFSS
LINSLSYKLITNFENTYLDSAFKKLENITNNILDDLNEFGAEKLGIIFENDNVFSNTLFLYNRIANLNDN
DCLVPIIDLSNALGRSIYTISGDKIVVTDHAKNNKFVSLLSIKEYQETPSNTLDKFLQLPIELIITEIFY
FVSKKQIISKLHGQDHILKITNDSILLNHKGINKFDEANVDFQFCNQQISIAVIEEDENKLAKAVAKAST
ELFKLGIIHVKEDINIEQIFWSQLPANFAFIRRISPLSVEHIASFTALHNTTLGNQYNPWGRAITLLRTE
KGTPYFMNFHDKTNKGNTCIFGTEKTGKTVLLNFLISESTKYEPTIIYISNNNDSKIFIEAIEGKWLEPD
KQIINPFLVDDTEQSQAFILEFLKLISGHYISPLSEIEISFLEKLKNKILSIEKEKRIFSNILKLANFKE
EGGIQIFDKLKVFTEGQLYYGLFDGPSLNIKEGEVIGFNLYTLSDEPFSKQFYPMERKFLEQFNHNLKKH
QSISAAVIYALSYNLSILGTKPKIFAADNFDQLYRPESYYDNINLIYNNLSENNGIFVSNFNFIYLKSYP
KYTIKPWLDLINTKIILPSDVKIEDLDKILGLSELEIRKLSQLILSARMFLINKDNESIASELSIAALIG
IVRILSSRQEEMDIYKKILQEHNGPPDNWINYLYNALNIY
 
Nucleotide Sequence: 2433 bp     [Download]
>gi|51473215|ref|NC_006142.1|:982177-984609 Rickettsia typhi str. Wilmington, complete genome
GTGTTTAGTGATTTACGGAAATTTGACAAAGATATATATAATTATAATGCGCCTAATTTTATACCTATAG
CATGTCATTATAATGAAAATACTTTACTTACCAAAGACGGTAAATTACTACAAATTGTAAAAATACACGG
TATTAACTCAGAGAAAATAAGCGACAATATACAAAATTTACGTGAAATGGTTAGACTTGCTATAAAAAAG
CATATAACCGATTATGATTTTGCTTTTTGGCTACACACAATACGAGAAAAACAAAACTTAGACGATACCA
CGCCTTATAAAAAATTATTACCAGCCAATATACATACACTATGGCAAAGAAAAAACCATTGGAATGATAA
ATTCGTTAATACTTTATATATATCTATAATACATGATTCTGCTAAAATTCAGATCAAAAATTTTAGTTCT
TTAATAAATTCATTATCTTATAAATTAATTACTAATTTTGAAAATACATACTTAGATTCAGCTTTTAAAA
AACTAGAAAATATCACCAATAATATTTTGGACGATTTAAATGAATTTGGGGCTGAAAAACTTGGGATAAT
ATTTGAAAATGATAATGTTTTTTCTAATACTTTATTTCTATATAATCGCATAGCTAATCTTAACGATAAT
GATTGTTTGGTGCCTATAATAGATTTATCCAATGCATTAGGTAGAAGCATTTATACAATTAGCGGCGATA
AAATAGTAGTTACAGATCATGCAAAAAATAACAAATTTGTTTCTTTATTATCTATCAAAGAATATCAAGA
AACTCCTTCTAATACACTGGATAAATTTTTGCAATTACCGATTGAATTAATAATAACTGAAATATTTTAC
TTTGTTAGCAAAAAACAAATAATATCCAAATTGCATGGTCAAGATCATATTCTTAAAATTACTAACGACT
CAATTTTACTTAATCACAAAGGAATTAATAAATTTGATGAAGCTAACGTAGATTTTCAATTTTGTAACCA
GCAAATTTCGATTGCAGTTATAGAAGAAGATGAAAATAAACTAGCCAAAGCTGTAGCAAAAGCATCAACA
GAACTCTTTAAGCTTGGTATTATTCATGTAAAAGAAGATATTAATATCGAGCAAATATTTTGGTCACAAT
TACCTGCTAACTTTGCTTTTATACGCAGAATATCACCACTATCTGTTGAACATATTGCGTCTTTTACTGC
TCTACATAATACTACACTCGGTAATCAATATAATCCCTGGGGCAGGGCTATAACTTTACTGCGAACTGAA
AAAGGTACACCATATTTCATGAATTTTCATGATAAAACAAATAAAGGTAATACTTGCATCTTTGGTACAG
AAAAAACTGGCAAAACCGTATTATTGAACTTTTTAATATCAGAATCAACCAAATATGAACCAACAATAAT
TTATATTTCTAATAATAATGATTCTAAAATTTTTATTGAGGCAATAGAAGGCAAATGGTTAGAACCGGAC
AAACAAATTATCAATCCATTTTTAGTAGATGATACAGAACAATCACAAGCTTTCATTTTAGAATTTTTAA
AATTAATCAGTGGTCATTATATTTCACCACTTAGTGAAATCGAGATATCTTTTCTAGAAAAATTGAAAAA
TAAAATTTTATCAATTGAAAAAGAAAAACGTATTTTTTCTAACATTTTAAAATTAGCAAATTTTAAAGAG
GAAGGAGGAATACAAATATTTGATAAACTTAAAGTTTTTACTGAAGGACAATTATATTACGGATTATTTG
ATGGGCCATCTCTTAACATTAAAGAAGGCGAAGTGATAGGGTTTAACTTATATACACTTTCTGATGAGCC
GTTTTCTAAACAATTCTATCCAATGGAGAGAAAATTTTTAGAACAATTTAATCATAATTTAAAAAAACAC
CAAAGTATTAGTGCAGCAGTAATTTATGCTTTGAGTTATAATTTAAGCATACTTGGCACAAAACCTAAAA
TATTTGCTGCTGATAATTTTGATCAACTTTACAGACCTGAATCTTATTATGATAATATAAATTTAATCTA
TAATAATTTATCAGAAAATAATGGTATTTTTGTCAGTAATTTCAATTTTATTTATCTTAAATCATATCCA
AAATATACTATAAAACCTTGGCTTGATTTAATTAATACTAAAATTATACTGCCCTCTGACGTTAAAATAG
AAGATTTAGATAAAATTTTAGGTTTAAGTGAATTGGAAATACGAAAATTATCACAGCTAATACTTTCTGC
AAGAATGTTCTTAATTAATAAAGATAATGAATCAATTGCTTCTGAATTAAGTATTGCAGCTTTAATAGGT
ATTGTACGTATTTTATCAAGCAGACAAGAGGAAATGGATATTTATAAAAAAATACTTCAAGAACATAACG
GTCCTCCAGATAATTGGATTAATTATCTATATAATGCGTTAAATATATACTAA
 Primer design