SecReT4
Protein ID: 51492531
T4SS name [ID]VirB [212]
Gene symbolvird4
Locus tagpFBAOT6.17
StrainAeromonas caviae plasmid pFBAOT6 (NC_006143)
Repliconplasmid pFBAOT6 [GenBank: NC_006143] [Browse all T4SS(s) in this replicon]
Location [Strand]16305..18230 [-]
ProductVird4 protein
Component typeVirD4
UniProt IDQ68E90
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2e-121, Aligned region: 98..544
TraG-D_C [PF12696], Evalue: 1.5e-29, Aligned region: 394..511
TrwB_AAD_bind [PF10412], Evalue: 6e-28, Aligned region: 137..520
Protein Sequence: 641 a.a.     [Download]
>gi|51492531|ref|YP_067828.1| Vird4 protein [Aeromonas caviae]
MTQNSNGHKWRKYAILFGVPLFILAWVWLAGAIFMAGNGLNAKEATPLTLYQYWYYYGDIKKTQAWITGA
AFGSLLILLLPVFLYFMPKKESLFGDARWATEKEIKDSGLYSEDGIIVGVKTAFFGLIKKYLIFGGAQHV
LMAAPTRSGKGVSIVIPNLLSWKDSVVVLDIKQENWDITSGFRAKHGQECYLLNLAPRDYRSHRWNPLFY
ISDDPNFRINDIQKIGQMLFPKVENEAPIWQSSARSLWLGLVLYLIETEELPVTMGEALRQLTMGDERLA
EIVEQRQESDNPLSDECYLALKEYLDTPDKTRGSVRKGFTASLELFYNPVIDAATSGNDFDLRDLRKRRM
SVYVGITPDDLDRLAPLINLFFQQVIDLNTRELPEQNPDLKHSCLLLMDEFTAMGKVGILSKGISYIAGY
GLRMLPIIQSPAQLRETYGADAAETFIDNHALQIVFAPKNIKVAKEISDSLGTKTVKNKSRSRQLTGKTS
RSENASDTGRALLMPQEVKQIGQKAEILLLENCPPIKCSKITWYADQTFNERGNGRDGVKFPSPAVPLVD
PNNRPKGEVSFHSNKIEDAETSEKTVVERDITVADIENIDNLNLDDFSCDFSKIEIPEGSISDDAMDDLV
SQFFNGLAEAA
 
Nucleotide Sequence: 1926 bp     [Download]
>gi|51492513|ref|NC_006143.1|:c18230-16305 Aeromonas caviae plasmid pFBAOT6, complete sequence
ATGACCCAGAATTCAAACGGACACAAATGGCGTAAATACGCCATTTTATTTGGCGTCCCTCTTTTTATAT
TGGCTTGGGTTTGGCTGGCTGGCGCAATTTTTATGGCTGGCAATGGTCTGAACGCCAAGGAAGCAACCCC
GTTGACCCTTTACCAATATTGGTACTATTACGGGGACATTAAAAAAACTCAAGCATGGATAACCGGGGCG
GCCTTTGGCTCCCTGCTTATTTTGCTCCTGCCAGTATTCCTTTACTTCATGCCAAAGAAAGAAAGCCTCT
TTGGCGATGCCAGGTGGGCAACTGAAAAAGAAATAAAGGATTCCGGTCTTTATTCTGAAGATGGGATTAT
TGTTGGCGTCAAAACTGCTTTTTTCGGCCTGATAAAAAAATATCTTATTTTCGGCGGGGCTCAACATGTC
TTAATGGCGGCCCCGACCCGTTCCGGTAAAGGTGTGAGTATTGTTATCCCCAATCTTTTGAGCTGGAAAG
ATAGCGTTGTTGTGCTGGATATAAAGCAAGAAAACTGGGATATAACTTCAGGTTTTCGCGCCAAACATGG
CCAAGAGTGCTATTTGCTGAACCTAGCTCCCCGAGATTATCGCTCGCACCGTTGGAATCCACTTTTTTAT
ATCTCTGATGACCCGAATTTCCGCATCAACGATATACAGAAAATCGGTCAGATGCTTTTCCCGAAAGTCG
AGAATGAAGCGCCTATTTGGCAATCCTCCGCTCGTAGCCTTTGGCTGGGCCTGGTGCTTTACCTTATCGA
GACTGAGGAACTGCCGGTTACGATGGGCGAGGCTCTGCGTCAGCTCACTATGGGCGATGAACGTCTGGCC
GAAATCGTAGAGCAGCGGCAAGAGTCTGATAACCCCTTATCAGATGAATGCTATCTAGCACTGAAAGAGT
ACCTGGACACCCCGGACAAGACTCGCGGCTCCGTTCGTAAAGGTTTCACGGCCTCCCTGGAGCTGTTTTA
TAACCCGGTGATCGATGCAGCAACCAGTGGCAATGATTTTGACCTGCGCGACCTGCGCAAACGCCGTATG
TCGGTTTATGTAGGGATTACCCCGGATGACCTGGATCGCCTGGCACCGTTGATTAATCTCTTTTTCCAGC
AGGTAATCGATCTCAATACCCGTGAGCTGCCCGAGCAAAATCCAGACCTGAAACATAGCTGTTTGCTGCT
TATGGATGAATTTACCGCTATGGGCAAGGTTGGCATTCTGTCAAAAGGTATTAGTTATATTGCAGGTTAT
GGCCTGCGTATGCTGCCAATTATCCAATCACCGGCACAGTTGCGTGAAACATATGGGGCTGATGCGGCGG
AAACATTCATTGATAACCACGCCTTGCAAATTGTTTTTGCTCCAAAAAACATCAAGGTAGCAAAGGAAAT
ATCCGACAGCCTGGGCACCAAGACAGTAAAAAACAAATCACGTAGTCGGCAACTCACCGGGAAAACAAGC
CGTTCTGAGAATGCCAGCGATACAGGCCGCGCCCTGCTTATGCCTCAAGAGGTTAAGCAGATTGGCCAAA
AGGCTGAAATATTGTTGTTGGAAAACTGCCCTCCTATTAAGTGCAGCAAAATAACTTGGTACGCCGACCA
GACTTTCAACGAGCGCGGCAACGGTCGTGATGGGGTTAAATTCCCCTCGCCTGCCGTTCCCCTGGTTGAC
CCTAACAACAGGCCGAAAGGTGAGGTTTCATTCCACTCCAACAAAATTGAAGACGCTGAAACTTCAGAAA
AAACTGTTGTGGAGCGGGATATTACCGTTGCTGACATTGAGAACATCGACAATTTGAACCTTGACGATTT
TTCTTGTGACTTCTCCAAGATTGAAATCCCTGAAGGCTCAATATCTGATGATGCAATGGACGACCTTGTA
AGCCAGTTTTTTAATGGCTTGGCTGAAGCGGCATAA
 Primer design