SecReT4
Protein ID: 51492532
T4SS name [ID]VirB [212]
Gene symbolvirB11
Locus tagpFBAOT6.18
StrainAeromonas caviae plasmid pFBAOT6 (NC_006143)
Repliconplasmid pFBAOT6 [GenBank: NC_006143] [Browse all T4SS(s) in this replicon]
Location [Strand]18196..19188 [-]
ProductVirB11 protein
Component typeVirB11
UniProt IDQ68E89
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.2e-67, Aligned region: 5..308
Protein Sequence: 330 a.a.     [Download]
>gi|51492532|ref|YP_067829.1| VirB11 protein [Aeromonas caviae]
MENLRILHPYLNRDGVTEIVINQPGEVITESRSGWERFDVPELNFNLCQDIAKLTATFSGQSLDERKPII
SATLPEGERVQIVVPPVTLSGRVSLTIRKPPTFNPTLDDYEKSGAFDQVIDYSSDLSEVERTLLELKQGR
KFKAFFELAIKSRLNIIVSGSTGSGKTTFMRSLLQLVPDDERLISIENVDELGLYKTHWNTVPLFYSAGG
QGVSEVSQQHLLESSLRMKPDRIFVAELIRGDEAFYYLRNVNSGHPGSITSMHANSARMAIEQLVLFLKE
SQSGSSMNREDIKQLLFMCVDIIVQIKNIRGKRVITEIYYDPEFKRTQMA
 
Nucleotide Sequence: 993 bp     [Download]
>gi|51492513|ref|NC_006143.1|:c19188-18196 Aeromonas caviae plasmid pFBAOT6, complete sequence
ATGGAGAATCTTCGGATTCTCCATCCTTATTTGAACCGCGACGGCGTTACAGAAATCGTCATTAATCAAC
CAGGTGAGGTTATTACAGAAAGCCGCTCTGGCTGGGAACGCTTTGACGTACCCGAGTTGAATTTCAACCT
TTGCCAGGACATAGCCAAACTTACCGCCACGTTTTCCGGTCAGTCTCTCGATGAACGGAAGCCGATAATC
TCGGCCACCCTACCAGAGGGGGAACGTGTTCAAATTGTCGTGCCTCCGGTAACACTGTCTGGCCGTGTCA
GCCTGACAATCCGAAAGCCGCCTACATTTAACCCCACGCTGGATGATTACGAGAAAAGCGGGGCGTTTGA
CCAGGTAATTGATTATTCATCTGACCTTAGCGAAGTTGAACGAACTCTTTTAGAACTCAAGCAAGGCCGG
AAGTTTAAGGCGTTTTTTGAGCTGGCGATCAAGTCTCGCCTAAACATCATTGTGTCAGGCTCAACCGGTA
GCGGTAAGACTACGTTTATGCGCTCCCTGCTTCAGCTTGTGCCTGATGATGAACGCCTGATTAGCATCGA
GAACGTGGATGAATTGGGGCTCTATAAGACACACTGGAACACCGTTCCGCTGTTCTATTCAGCCGGTGGG
CAAGGGGTATCTGAAGTTAGTCAGCAACACCTGTTGGAAAGCTCATTGCGCATGAAGCCAGACCGGATTT
TTGTGGCTGAGTTGATCCGGGGGGATGAAGCCTTTTACTACCTGAGAAACGTCAACTCTGGCCACCCTGG
ATCGATTACCTCCATGCACGCCAACAGCGCCAGAATGGCTATAGAACAACTGGTTTTGTTCTTGAAGGAA
AGCCAAAGCGGCAGCTCGATGAATAGAGAGGATATTAAGCAACTTCTCTTTATGTGCGTCGATATTATCG
TGCAGATTAAAAACATTCGCGGGAAACGGGTAATAACGGAGATTTACTATGACCCAGAATTCAAACGGAC
ACAAATGGCGTAA
 Primer design