SecReT4
Protein ID: 51492535
T4SS name [ID]VirB [212]
Gene symbolvirB8
Locus tagpFBAOT6.21
StrainAeromonas caviae plasmid pFBAOT6 (NC_006143)
Repliconplasmid pFBAOT6 [GenBank: NC_006143] [Browse all T4SS(s) in this replicon]
Location [Strand]21252..22001 [-]
ProductVirB8 protein
Component typeVirB8
UniProt IDQ68EA0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.8e-58, Aligned region: 23..245
Protein Sequence: 249 a.a.     [Download]
>gi|51492535|ref|YP_067832.1| VirB8 protein [Aeromonas caviae]
MTAKGDNKKPGKGKTIDQQYFEEARGWDSDAIAKTKQSERRAWRVAGVAVTVAILEAIGISSVLPLKTVE
PFVIRVDNNTGLTDVVSTLKEKDEGVKATAQEALNKYWLAQYIRHREGYLWDTRDYDREMVGLLSAPTIQ
QQYAEYTDPRKNPQAPIVVYGQNSEVETKVKAISMLNTGEELEGETRYTALVRYTKQVRRAGEFSPITHW
AATITFAYRNEPMRLDDRTKNPLGFQVISYRNDQEAGGL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|51492513|ref|NC_006143.1|:c22001-21252 Aeromonas caviae plasmid pFBAOT6, complete sequence
ATGACGGCTAAAGGTGACAATAAAAAGCCTGGCAAGGGTAAAACCATCGACCAGCAATATTTTGAGGAAG
CGCGGGGCTGGGATAGCGATGCTATCGCCAAAACCAAGCAATCAGAGCGGCGGGCCTGGCGAGTTGCTGG
CGTGGCCGTGACAGTGGCCATCCTGGAAGCTATCGGGATCTCGTCTGTCCTCCCCCTCAAAACCGTTGAG
CCGTTTGTTATTCGGGTTGATAACAATACCGGCCTGACTGACGTTGTAAGCACCCTGAAGGAGAAGGACG
AAGGCGTAAAAGCCACAGCTCAAGAGGCGCTGAATAAATACTGGCTGGCGCAATATATCCGGCACCGTGA
GGGCTATTTGTGGGATACCCGTGACTATGATCGGGAAATGGTCGGCTTGCTCTCCGCACCGACGATACAA
CAGCAATATGCCGAATACACCGACCCCCGCAAAAACCCACAAGCGCCGATTGTGGTATATGGCCAAAACT
CCGAAGTAGAAACCAAGGTTAAAGCCATTTCCATGCTGAACACAGGGGAGGAGCTGGAAGGCGAAACCCG
TTATACCGCCCTGGTTCGCTATACCAAGCAGGTGCGCCGTGCCGGTGAGTTCTCACCGATCACCCACTGG
GCCGCGACGATCACGTTTGCTTATCGCAATGAGCCTATGAGGCTCGACGACCGCACCAAAAACCCGCTTG
GCTTCCAAGTGATTTCCTATCGCAATGACCAAGAAGCCGGGGGACTCTAA
 Primer design