SecReT4
Protein ID: 51593954
T4SS name [ID]VirB [409]
Gene symboltriG
Locus tagpYptb0012
StrainYersinia pseudotuberculosis IP 32953
Repliconplasmid pYptb32953 [GenBank: NC_006154] [Browse all T4SS(s) in this replicon]
Location [Strand]9186..9869 [+]
ProductTriG protein
Component typeVirB8
UniProt IDQ663E2
KEGG IDyps:pYptb0012
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.6e-60, Aligned region: 11..223
Protein Sequence: 227 a.a.     [Download]
>gi|51593954|ref|YP_068520.1| TriG protein [Yersinia pseudotuberculosis IP 32953]
MSKTKQLINASKTFEEKLLTRDARDKKVGFFIGGTGLLMGVFGIVAVIMLLPLKETELELYTVDNTTGRV
EKITHVKQQDISSHEALAKAFAANYVKLRESYNYFSLQHDYDTVPLFGSDAVNADYLAFFNGKNSPDMVY
QKAAYVVNIEIISNVISDATDPDKLAQIRFKKTLRRVADGNTKVEYWNSRVTFRYVPEKALTEAQREANP
LGFTVTSYQRDKEIRGE
 
Nucleotide Sequence: 684 bp     [Download]
>gi|51593942|ref|NC_006154.1|:9186-9869 Yersinia pseudotuberculosis IP 32953 plasmid pYptb32953, complete sequence
ATGTCGAAAACCAAGCAATTAATTAATGCGTCAAAAACGTTTGAAGAAAAACTATTAACACGAGACGCCC
GCGATAAGAAAGTGGGCTTTTTTATAGGTGGAACAGGGTTATTAATGGGGGTGTTTGGAATAGTGGCGGT
AATAATGTTGTTGCCATTAAAAGAAACCGAGCTTGAATTATATACCGTGGATAATACGACAGGGAGAGTT
GAGAAAATAACCCACGTTAAACAGCAAGATATTTCCTCTCATGAAGCATTAGCAAAAGCCTTTGCCGCCA
ATTACGTGAAATTGCGTGAAAGTTATAACTATTTCTCGCTGCAACATGATTATGACACTGTGCCATTGTT
TGGCTCTGATGCCGTTAATGCTGACTATCTCGCCTTCTTTAACGGTAAGAATTCACCGGATATGGTTTAT
CAGAAAGCCGCTTATGTGGTGAATATTGAAATAATTTCCAATGTCATTAGTGATGCAACCGACCCCGATA
AACTCGCCCAAATCCGCTTTAAAAAGACCCTTCGCCGTGTGGCGGATGGTAATACCAAAGTGGAGTATTG
GAATTCGAGGGTGACGTTCCGCTATGTGCCAGAAAAGGCACTGACCGAGGCACAGCGTGAAGCTAATCCG
TTAGGGTTCACAGTGACCAGTTACCAGCGTGATAAAGAAATCAGGGGGGAATAA
 Primer design