SecReT4
Protein ID: 51593957
T4SS name [ID]VirB [409]
Gene symboltriJ
Locus tagpYptb0015
StrainYersinia pseudotuberculosis IP 32953
Repliconplasmid pYptb32953 [GenBank: NC_006154] [Browse all T4SS(s) in this replicon]
Location [Strand]12262..13275 [+]
ProductTriJ protein
Component typeVirB11
UniProt IDQ663D9
KEGG IDyps:pYptb0015
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.4e-49, Aligned region: 16..279
Protein Sequence: 337 a.a.     [Download]
>gi|51593957|ref|YP_068523.1| TriJ protein [Yersinia pseudotuberculosis IP 32953]
MIKNKSLDTFKNKLFGDFLALDGLTEIAVNRPNQLFTKVNGVWQKHTHAISLDQCMQFSTALANYNKDHV
EDIKPILSATLESGERCQIVMPPACQGDTVSITIRKPSKLQIPHQSYIDSGFYSRVMGSETADNHDTELL
RLYSENIPLFMEKCVEYGKVILFVGKTSSGKTTYMKTLIGYIPLGLRIVTIEDNPEIEFRQHENYVHLFY
PSEGGEDAIVSPASLIRANFRMNPDRILLTEVRGPEAWDALKIIGSGHDGLITSMHAGTPTEAIDGLVTR
CYQNPECRQLPYSVLLRKVLDSVDVIASIDVNGNVRRMGDVYFKPVHRQKFLEEFTK
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|51593942|ref|NC_006154.1|:12262-13275 Yersinia pseudotuberculosis IP 32953 plasmid pYptb32953, complete sequence
ATGATTAAAAACAAGTCTCTCGATACATTCAAAAATAAACTGTTCGGTGATTTTCTGGCGCTGGACGGGT
TGACAGAAATAGCGGTCAATCGCCCTAATCAGTTATTCACCAAAGTTAACGGGGTGTGGCAGAAACATAC
CCATGCTATTTCACTGGATCAGTGCATGCAGTTCAGTACCGCGCTGGCGAATTACAACAAAGACCATGTC
GAAGATATCAAACCGATATTGTCCGCTACGCTGGAGTCTGGCGAACGCTGCCAGATTGTCATGCCTCCGG
CTTGTCAGGGCGATACCGTTTCTATCACCATCCGTAAGCCCTCCAAGTTACAGATACCTCATCAATCCTA
CATTGACAGTGGATTCTACAGTCGAGTAATGGGCAGTGAAACGGCAGATAATCACGATACTGAACTGCTG
CGGTTATATTCTGAGAACATTCCGTTGTTCATGGAAAAGTGTGTGGAGTACGGAAAAGTCATTCTTTTTG
TGGGTAAAACCAGCTCGGGGAAGACGACTTACATGAAAACCCTGATTGGCTATATCCCGTTGGGGCTGCG
GATAGTGACCATTGAAGACAACCCCGAAATTGAATTTCGTCAGCATGAGAACTATGTGCATCTGTTTTAT
CCGTCAGAGGGTGGAGAAGATGCCATCGTCAGCCCTGCCAGTCTGATACGGGCTAATTTTCGCATGAACC
CTGACCGGATATTGCTAACAGAAGTCAGGGGGCCGGAAGCGTGGGACGCGCTAAAGATTATTGGTTCAGG
TCATGATGGGTTAATCACGTCAATGCACGCTGGCACCCCCACAGAGGCGATTGATGGTCTTGTAACGCGC
TGCTATCAAAATCCTGAATGTCGTCAACTGCCTTACAGCGTCTTGCTGCGCAAGGTGCTGGACAGTGTGG
ATGTGATAGCCAGCATCGATGTCAACGGTAACGTTCGCCGTATGGGGGATGTTTACTTTAAACCGGTACA
CCGTCAGAAATTCCTTGAGGAATTTACTAAATGA
 Primer design