SecReT4
Protein ID: 51593970
T4SS name [ID]VirB [409]
Gene symboltriK
Locus tagpYptb0029
StrainYersinia pseudotuberculosis IP 32953
Repliconplasmid pYptb32953 [GenBank: NC_006154] [Browse all T4SS(s) in this replicon]
Location [Strand]18485..20266 [+]
ProductTriK protein
Component typeVirD4
UniProt IDQ663C6
KEGG IDyps:pYptb0029
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.8e-13, Aligned region: 344..534
TrwB_AAD_bind [PF10412], Evalue: 4.5e-10, Aligned region: 184..224
TrwB_AAD_bind [PF10412], Evalue: 4.5e-10, Aligned region: 397..540
TraG-D_C [PF12696], Evalue: 2.7e-09, Aligned region: 398..524
DUF87 [PF01935], Evalue: 1.4e-06, Aligned region: 172..232
Protein Sequence: 593 a.a.     [Download]
>gi|51593970|ref|YP_068536.1| TriK protein [Yersinia pseudotuberculosis IP 32953]
MSNQIMQKLSVISDNAIAFFAYLQAHQLLLALLAGLTLPFIFFLTKDEHEKAPTWQKCVIVFSFICLLFG
TLSPLSFGVIYYIYERAGFNVSPVLWGVLIAFTTVGIVFHYVARRMLAPELDKLKHKLIKKSSLERNVRT
DVRNVKALLPKTEHYNPADYIDLNKGIFVGLDEHHQPMYIPVSDWQKQHAAIIGTTGAGKGVATGLLLTQ
SIMAGEGVFVLDPKDDEWAPHLFRKACEDAGKPFALINLNKPEYQLNLIANINADQLEELFIAGFSLAEK
GEAADFYRIDDRRAARAAAQIINDNPTATVRDLFNSEYVQSIGEDIKGFFGKIEELALLNSINAVDGFDL
KKIFDEGGCCYVIGSLRNSKVIMTQRMILVRLLQLAETRDRINSTPRPIAIFLDEFKYHISRPALEGLGA
ARDKGVHVSMAFQAIDDLRDCPADLNGDAVVGAVVENAKFKLVYKLQNPETAEWVAKMSGTILVDDESRK
AKTSKVLTETIDDERTIRQAERYFIDSNMLLNLPPFVSYIFTATDLPRASLISPIKVKKQALVIHSAPLE
KQKEVHKDLDFVETPPIPPTKKKVEAEEESPLF
 
Nucleotide Sequence: 1782 bp     [Download]
>gi|51593942|ref|NC_006154.1|:18485-20266 Yersinia pseudotuberculosis IP 32953 plasmid pYptb32953, complete sequence
ATGAGCAATCAAATTATGCAGAAGCTCTCTGTAATAAGTGATAACGCTATAGCGTTCTTCGCTTATTTAC
AGGCACACCAATTGTTATTAGCCTTACTCGCGGGGCTGACATTGCCTTTTATTTTTTTTCTCACGAAGGA
TGAGCACGAAAAAGCCCCGACATGGCAGAAATGTGTCATTGTATTTTCGTTTATTTGCTTATTATTTGGC
ACGCTGTCACCGTTGAGCTTTGGCGTTATATATTATATTTATGAGAGAGCGGGGTTTAATGTTTCCCCTG
TTCTATGGGGCGTTCTTATTGCTTTTACTACAGTGGGAATTGTATTTCACTATGTTGCGCGGCGAATGTT
AGCGCCAGAATTGGATAAACTAAAACATAAGTTGATAAAGAAATCCAGTTTGGAGCGTAATGTACGAACT
GATGTTCGCAACGTAAAAGCGCTGTTACCGAAAACGGAACATTACAATCCGGCGGATTACATTGACCTCA
ATAAAGGAATTTTTGTTGGACTCGATGAACATCATCAACCGATGTACATTCCAGTTTCAGACTGGCAAAA
ACAACATGCGGCAATTATCGGAACAACTGGGGCTGGTAAAGGTGTGGCTACTGGTCTGCTTTTGACTCAA
AGCATTATGGCTGGGGAGGGTGTTTTTGTATTAGACCCAAAAGATGATGAGTGGGCACCCCATTTATTCC
GTAAAGCTTGTGAGGATGCCGGAAAACCATTTGCATTAATCAACTTGAATAAACCCGAGTACCAACTTAA
CTTAATCGCAAACATCAATGCGGATCAGCTTGAAGAATTATTTATCGCAGGATTCAGTTTGGCAGAAAAA
GGCGAAGCAGCCGATTTTTATCGCATTGATGATCGCCGTGCTGCCCGTGCCGCTGCCCAAATTATAAACG
ACAATCCGACAGCTACAGTTCGTGACCTATTTAATAGTGAGTATGTACAAAGTATTGGCGAAGACATTAA
AGGATTTTTCGGTAAGATTGAAGAACTCGCGTTATTAAACTCCATCAATGCAGTCGATGGTTTTGACCTT
AAAAAGATTTTTGATGAAGGTGGCTGCTGTTATGTCATCGGTTCTTTGCGTAATAGCAAAGTCATCATGA
CACAGAGAATGATTTTAGTCCGACTGTTACAGCTTGCTGAAACGCGAGATAGAATAAACAGTACACCACG
CCCGATTGCAATTTTTCTTGATGAGTTTAAATACCACATATCCCGTCCAGCACTCGAAGGTTTAGGTGCG
GCACGTGATAAAGGCGTACATGTTTCGATGGCATTTCAGGCCATCGATGATTTACGGGACTGTCCGGCGG
ATTTAAATGGTGATGCAGTAGTGGGTGCAGTTGTAGAGAATGCGAAATTTAAACTGGTATATAAGCTACA
AAATCCTGAAACTGCCGAATGGGTGGCTAAAATGTCGGGAACAATCCTTGTTGATGATGAGAGCCGCAAA
GCTAAAACAAGTAAAGTTTTGACAGAAACAATTGACGATGAACGAACAATAAGACAGGCAGAACGTTATT
TTATTGATAGCAATATGCTGTTAAATCTCCCTCCTTTCGTCAGTTATATATTTACCGCCACTGATTTACC
CCGCGCATCTTTAATCTCACCGATTAAAGTTAAAAAACAAGCATTGGTTATTCATTCCGCCCCGTTAGAA
AAGCAAAAAGAAGTACATAAAGATTTAGATTTTGTTGAAACACCTCCCATTCCTCCTACTAAGAAGAAAG
TAGAAGCAGAGGAAGAATCTCCTTTATTCTGA
 Primer design