SecReT4
Protein ID: 52788140
T4SS name [ID]Tra_F [123]
Gene symboltraL
Locus tagpG8786_088
StrainYersinia pestis plasmid pG8786 (NC_006323)
Repliconplasmid pG8786 [GenBank: NC_006323] [Browse all T4SS(s) in this replicon]
Location [Strand]82631..82936 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDQ65AI0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.3e-37, Aligned region: 8..101
Protein Sequence: 101 a.a.     [Download]
>gi|52788140|ref|YP_093968.1| conjugal transfer pilus assembly protein TraL [Yersinia pestis]
MADESLTKYRFPETLTNQSRWFGLPVDELIPAIVCLGWGFWTQHYIPGIIAAVLAYLGIKKLKKGRGSSW
LRDLVYWYMPTSLLRGIFHDVPDSCYRQWIK
 
Nucleotide Sequence: 306 bp     [Download]
>gi|52788052|ref|NC_006323.1|:82631-82936 Yersinia pestis plasmid pG8786, complete sequence
ATGGCAGATGAATCTCTCACAAAATATCGCTTTCCCGAAACCCTGACGAATCAGAGCCGCTGGTTTGGCC
TTCCTGTGGATGAACTTATTCCGGCCATTGTCTGCCTGGGGTGGGGATTCTGGACCCAGCATTATATTCC
CGGAATTATCGCTGCCGTACTGGCCTATCTCGGAATTAAAAAGCTCAAGAAAGGGCGGGGCAGTTCATGG
CTGCGGGACCTGGTCTACTGGTATATGCCGACCTCACTGCTGAGGGGGATTTTTCATGATGTACCCGACT
CATGCTACCGCCAGTGGATTAAATAG
 Primer design