SecReT4
Protein ID: 52788153
T4SS name [ID]Tra_F [123]
Gene symboltraF
Locus tagpG8786_102
StrainYersinia pestis plasmid pG8786 (NC_006323)
Repliconplasmid pG8786 [GenBank: NC_006323] [Browse all T4SS(s) in this replicon]
Location [Strand]95017..95766 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDQ65AG7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.4e-75, Aligned region: 25..239
Protein Sequence: 249 a.a.     [Download]
>gi|52788153|ref|YP_093981.1| conjugal pilus assembly protein TraF [Yersinia pestis]
MKKRKTALALLLLGSVFSATGKDAGWQWYNESHRTPEDDKSSSAQPQQASPDIMEKLATLQQATKRAMYE
AILYPGVENFTRYFRLQNYWTQQAGLFSMSAKKAMLEHPELDYNLQHSHYNGTVRNQLAADFADQRLAIE
TLAQRYGVMFFYRGQDPIDGQLVQVIKNFRETYHLSVIPVSVDGIVNPLLPDTRMDGGQASRLGIRYFPA
LMLADPKSGTVKPVSYGFISQDDLAKQFLNVSTDFAPNF
 
Nucleotide Sequence: 750 bp     [Download]
>gi|52788052|ref|NC_006323.1|:95017-95766 Yersinia pestis plasmid pG8786, complete sequence
GTGAAAAAGAGAAAGACAGCGTTAGCGCTGCTGCTTCTTGGCAGCGTTTTTTCCGCCACAGGAAAAGATG
CCGGCTGGCAGTGGTACAACGAATCGCACAGAACGCCGGAGGACGACAAATCCTCTTCAGCACAGCCTCA
GCAGGCCTCGCCGGACATCATGGAGAAGCTTGCCACGCTTCAGCAGGCCACGAAGCGCGCCATGTACGAG
GCCATTCTGTATCCGGGCGTGGAGAACTTTACCCGTTACTTCCGCCTGCAGAACTACTGGACGCAGCAGG
CCGGGCTGTTCTCGATGAGTGCTAAAAAGGCGATGCTCGAGCACCCCGAACTGGACTACAACCTGCAGCA
CAGCCACTACAACGGTACCGTGCGCAACCAGCTGGCGGCGGACTTTGCCGACCAGCGCCTCGCCATTGAA
ACGCTGGCACAGCGCTATGGCGTGATGTTCTTCTACCGCGGACAGGACCCGATCGACGGCCAGCTGGTTC
AGGTCATTAAAAACTTCCGCGAGACGTATCACCTCAGCGTCATTCCGGTCTCTGTGGACGGTATCGTGAA
TCCACTCCTGCCGGATACCCGAATGGACGGTGGACAGGCCAGCCGGCTGGGTATTCGTTACTTCCCGGCG
CTGATGCTGGCCGACCCTAAAAGCGGGACGGTCAAACCCGTCTCGTATGGCTTTATCAGCCAGGATGACC
TGGCGAAGCAGTTCCTCAACGTTTCCACAGATTTTGCCCCCAACTTTTAA
 Primer design