SecReT4
Protein ID: 52788154
T4SS name [ID]Tra_F [123]
Gene symboltraQ
Locus tagpG8786_103
StrainYersinia pestis plasmid pG8786 (NC_006323)
Repliconplasmid pG8786 [GenBank: NC_006323] [Browse all T4SS(s) in this replicon]
Location [Strand]95693..96031 [+]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDQ65AG6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 1.7e-40, Aligned region: 31..111
Protein Sequence: 112 a.a.     [Download]
>gi|52788154|ref|YP_093982.1| conjugal transfer pilin chaperone TraQ [Yersinia pestis]
MALSARMTWRSSSSTFPQILPPTFNTGRVRMRKFRFRLPEFDVPGLWVLSLGIWFHIVSRLVRREPEMAI
LLAQIIGVSMVLWGGYRIINRWIDAAREAEKARDAGGCRHEP
 
Nucleotide Sequence: 339 bp     [Download]
>gi|52788052|ref|NC_006323.1|:95693-96031 Yersinia pestis plasmid pG8786, complete sequence
ATGGCTTTATCAGCCAGGATGACCTGGCGAAGCAGTTCCTCAACGTTTCCACAGATTTTGCCCCCAACTT
TTAATACAGGGAGAGTTCGCATGCGCAAATTCCGTTTTCGCCTGCCCGAGTTCGACGTGCCCGGATTATG
GGTGCTGAGCCTCGGGATATGGTTTCACATTGTTTCCCGCCTGGTCCGGCGCGAGCCGGAGATGGCCATT
CTTCTGGCGCAGATAATCGGCGTATCGATGGTGCTCTGGGGGGGCTACCGCATTATCAACCGCTGGATTG
ATGCTGCCCGTGAGGCCGAAAAGGCCCGTGATGCCGGAGGATGCCGACATGAACCTTAG
 Primer design