SecReT4
Protein ID: 52788160
T4SS name [ID]Tra_F [123]
Gene symboltraX
Locus tagpG8786_109
StrainYersinia pestis plasmid pG8786 (NC_006323)
Repliconplasmid pG8786 [GenBank: NC_006323] [Browse all T4SS(s) in this replicon]
Location [Strand]109380..110255 [+]
ProductTraX protein
Component typeTraX_F
UniProt IDQ65AG0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 3e-51, Aligned region: 75..290
Protein Sequence: 291 a.a.     [Download]
>gi|52788160|ref|YP_093988.1| TraX protein [Yersinia pestis]
MRRKNAAGMRRCLRWCARACSGTACSRWSAKRCETLSVKRPWEATDMRAENHPLFPLVVVADCWLQRLLV
WTPGQTDLIKTVALLLMVADHISMLCGLDNDWLRLAGRGAFPLFGLVWAMNLARHPQIQQRALNRLWIWA
GVAQGGWILAGLRPDLGNILFAFAVSGQALALMQRHGPRTWPLSLMLVLAWLPFSAGSYGLAGVVMLMLA
CGVCMTGRRTTRTGLALCLALAILALNAADSPAFAIAGLVIPGVTLTVLSRTCCRVPRFWPREFFPLFYA
VHLAVIGLMVM
 
Nucleotide Sequence: 876 bp     [Download]
>gi|52788052|ref|NC_006323.1|:109380-110255 Yersinia pestis plasmid pG8786, complete sequence
ATGCGCCGGAAGAACGCCGCCGGGATGAGGCGGTGTCTCAGGTGGTGCGCGAGAGCGTGCAGCGGGACCG
CCTGCAGCAGATGGAGCGCGAAACGGTGCGAGACCTTGAGCGTGAAAAGACCCTGGGAGGCGACTGATAT
GCGCGCTGAAAACCATCCGCTCTTCCCCCTTGTGGTGGTGGCCGACTGCTGGCTGCAGCGTCTGCTTGTG
TGGACGCCGGGCCAGACCGACCTTATCAAAACCGTGGCGCTCCTCCTGATGGTGGCCGACCACATCAGCA
TGCTGTGCGGACTGGATAATGACTGGCTGCGTCTTGCCGGTCGGGGAGCGTTTCCGCTCTTTGGCCTGGT
CTGGGCCATGAACCTCGCCCGCCATCCGCAGATTCAGCAGCGCGCCCTGAACCGGCTCTGGATATGGGCC
GGGGTGGCGCAGGGCGGCTGGATACTGGCCGGGCTGCGCCCGGACCTGGGCAATATCCTGTTTGCCTTTG
CGGTCAGCGGACAGGCGCTGGCGCTGATGCAGCGGCACGGGCCGCGCACGTGGCCGCTCTCCCTGATGCT
GGTTCTGGCCTGGCTGCCGTTTTCGGCGGGAAGCTACGGGCTGGCGGGGGTAGTGATGCTGATGCTGGCC
TGCGGCGTATGTATGACGGGCCGGCGCACCACGCGCACGGGGCTGGCGCTGTGTCTGGCACTGGCGATAC
TCGCGCTGAATGCCGCGGACAGCCCCGCCTTTGCCATCGCGGGTCTGGTAATACCCGGCGTTACCCTGAC
AGTGCTGAGTCGGACCTGTTGCCGCGTGCCGAGGTTCTGGCCGCGCGAATTTTTCCCGCTGTTCTACGCG
GTGCACCTTGCCGTCATCGGACTGATGGTGATGTGA
 Primer design