SecReT4
Protein ID: 52841221
T4SS name [ID]Tfc [749]
Gene symbol-
Locus taglpg0987
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]1080143..1081510 [-]
ProductTfp pilus assembly, pilus retraction ATPase PilT
Component typeTfc22
UniProt IDQ5ZWU8
KEGG IDlpn:lpg0987
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 455 a.a.     [Download]
>gi|52841221|ref|YP_095020.1| Tfp pilus assembly, pilus retraction ATPase PilT [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MKKSLLIALLVPTLTHAGSFMPSQSDYYYELGGTSNLFIPPVNKDQTLVIGADIDGRMGFSCSGFNPVVS
ITNTFQDLKKSALNIPGGVIDNLKGSVAGFPLYKLQQSMPALYNVLQNAASSAQNEFTLKVKDCQEVKQA
LEQNQSPMEGILSVSDSQGWLDAAKRAKKENVDVTETSKSIAQKRDEYGLPWIGSNKGNAGGKFQRPIKV
INDVVIAGYNILLERKPLDSLEKPSTKIPMVQSWPTPTDAANWAVKVLGDIQVSSSENKQSHDAKAGIGL
SALLQSCANANTCSQNIAKALWNLVNGTWTLTEENLSKVSASNLLITDEVITTIQHLPREEQMLTVSKLA
EEIAVQNMLDKALMMRRILQAGLQVQEVQNLKPAMNMVLFALKKLDDDIHSLSFENDVRKKMMTETLGTI
MDIRHQAQSQNMPGQDHEQPAVKNGAIYVKENKGA
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c1081510-1080143 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
ATGAAGAAATCTCTATTAATAGCTTTACTCGTTCCAACACTGACCCATGCTGGCAGCTTTATGCCCAGCC
AATCGGATTACTATTATGAATTAGGAGGAACATCTAATTTATTTATTCCGCCCGTAAATAAAGATCAAAC
GCTGGTTATTGGTGCAGATATTGATGGCCGTATGGGATTCTCTTGTAGCGGTTTTAATCCTGTCGTATCC
ATTACCAATACCTTTCAGGATTTAAAAAAATCAGCATTAAATATCCCTGGTGGTGTCATTGATAATTTAA
AAGGTTCAGTCGCAGGATTCCCTCTTTATAAGCTGCAACAGTCCATGCCTGCTTTATACAATGTTCTACA
AAACGCTGCATCCAGTGCACAAAACGAATTTACCCTCAAGGTTAAAGATTGTCAGGAAGTCAAACAAGCA
CTGGAACAAAACCAATCTCCAATGGAAGGCATATTATCAGTATCCGATAGTCAAGGATGGCTTGATGCTG
CCAAACGAGCTAAAAAGGAAAACGTCGATGTGACCGAAACATCAAAAAGCATCGCTCAAAAGCGAGATGA
ATATGGTCTACCCTGGATAGGCAGCAATAAAGGCAATGCGGGCGGTAAGTTTCAACGCCCCATTAAGGTA
ATTAATGATGTAGTCATTGCGGGCTACAACATTCTTTTAGAGAGAAAACCTTTAGATTCTTTGGAAAAAC
CAAGCACCAAAATTCCTATGGTACAAAGCTGGCCAACACCTACCGATGCTGCTAATTGGGCAGTTAAGGT
TCTTGGCGATATCCAGGTCAGCAGCAGTGAAAACAAACAAAGCCATGATGCTAAAGCAGGGATTGGTTTA
TCAGCTTTATTGCAAAGCTGCGCGAACGCCAATACCTGTAGCCAGAACATTGCCAAGGCCTTATGGAATT
TAGTCAATGGTACTTGGACGCTTACTGAAGAAAATCTGAGTAAAGTCAGTGCCTCCAATTTACTGATTAC
TGATGAAGTCATTACTACTATTCAGCACCTGCCCCGTGAAGAACAAATGCTTACTGTCTCAAAACTGGCA
GAAGAAATCGCTGTTCAAAATATGCTGGATAAAGCCTTAATGATGCGCCGCATCTTACAAGCAGGATTAC
AAGTGCAAGAAGTACAGAATTTAAAACCTGCTATGAATATGGTCTTGTTTGCCCTGAAAAAACTAGACGA
TGACATTCATTCTTTGTCCTTTGAAAACGATGTCCGCAAAAAAATGATGACTGAGACTTTGGGAACCATC
ATGGACATTCGCCATCAAGCCCAAAGCCAAAATATGCCAGGCCAGGATCACGAACAGCCTGCTGTTAAAA
ACGGCGCAATCTACGTTAAAGAAAATAAAGGAGCTTAA
 Primer design