SecReT4
Protein ID: 52841228
T4SS name [ID]Tfc [749]
Gene symbol-
Locus taglpg0994
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]1088219..1088581 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDQ5ZWU1
KEGG IDlpn:lpg0994
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.1e-09, Aligned region: 11..113
Protein Sequence: 120 a.a.     [Download]
>gi|52841228|ref|YP_095027.1| hypothetical protein lpg0994 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MSQPSSRHLSHDFPAWKGLSLRELFWIVITTTPVTTLLFILLGTMAGYPLAAGCIGFVIGFILSITVWPK
GVARIKAGKPYGYVMKKTIQWMVRLRLKHSPWIHYQGQWQKNKSVGEPHV
 
Nucleotide Sequence: 363 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c1088581-1088219 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
ATGAGTCAGCCTTCTTCGCGCCATCTATCACATGACTTCCCAGCCTGGAAAGGCTTAAGTCTGCGTGAAT
TGTTTTGGATTGTCATCACTACAACACCAGTAACCACCCTGCTTTTTATCCTTTTAGGAACAATGGCAGG
ATATCCACTGGCCGCTGGCTGCATCGGTTTTGTGATTGGATTCATCCTCTCCATTACCGTATGGCCAAAA
GGAGTCGCCCGTATCAAAGCAGGCAAACCTTATGGTTATGTGATGAAGAAAACCATTCAATGGATGGTGC
GATTAAGGCTCAAACACTCGCCCTGGATTCATTATCAGGGACAGTGGCAAAAGAATAAATCTGTTGGAGA
GCCTCATGTTTGA
 Primer design