SecReT4
Protein ID: 52841231
T4SS name [ID]Tfc [749]
Gene symbol-
Locus taglpg0997
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]1089221..1089547 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDQ5ZWT8
KEGG IDlpn:lpg0997
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 4.1e-05, Aligned region: 24..103
Protein Sequence: 108 a.a.     [Download]
>gi|52841231|ref|YP_095030.1| hypothetical protein lpg0997 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MKRILCLILVIISLQCSANNPDLNETLVRIINQINAIMPLLDEAQTQITPNARIQLQIEGFEDLQGQHHA
GLREDLLNIRNGLIDYINQPIIAPRKIKPLEMDFVRKP
 
Nucleotide Sequence: 327 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c1089547-1089221 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
ATGAAACGAATATTATGCCTGATCTTAGTGATAATAAGCCTGCAATGCTCAGCGAATAACCCTGATTTGA
ATGAAACCTTGGTACGCATTATTAATCAGATTAACGCCATCATGCCTTTGCTTGATGAAGCGCAAACACA
GATAACACCTAACGCTCGTATCCAATTGCAAATCGAAGGATTTGAAGATCTGCAAGGACAACATCACGCA
GGATTGAGAGAGGACTTGCTAAACATCCGCAACGGGCTGATTGACTATATCAACCAGCCCATCATTGCCC
CTCGAAAAATTAAACCATTAGAAATGGATTTTGTGAGGAAGCCCTAA
 Primer design