SecReT4
Protein ID: 52841232
T4SS name [ID]Tfc [749]
Gene symbol-
Locus taglpg0998
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]1089557..1090189 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDQ5ZWT7
KEGG IDlpn:lpg0998
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 5e-42, Aligned region: 87..207
Protein Sequence: 210 a.a.     [Download]
>gi|52841232|ref|YP_095031.1| hypothetical protein lpg0998 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MAVKQYSRQLTMQLTIVLFLGWLAIIIWALSQWMLHGYPIAFEKVNILVNTQREAITPVYQGSLLAVLPL
NAKPDWAFAIPYLNKLAINDLAKDLIEKSQQLLQILLLSSKCLLIKLIILFAALPLFALTMIAGLVDGLN
QRAIRTACLGRESSYVFHRLNHYLKKGLVILLILWLALPVSITPAYVFVPVSLLMGLMVAMTASRFKKYL
 
Nucleotide Sequence: 633 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c1090189-1089557 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
ATGGCAGTAAAGCAATATTCAAGGCAACTGACCATGCAATTAACCATAGTGCTATTCTTAGGTTGGTTAG
CAATTATTATCTGGGCATTGAGCCAATGGATGCTGCATGGCTACCCCATCGCTTTTGAAAAAGTGAATAT
CCTTGTAAACACTCAAAGAGAGGCTATTACTCCTGTTTATCAAGGCTCCCTTCTGGCAGTCCTTCCTTTA
AATGCCAAACCAGATTGGGCATTCGCCATTCCCTACTTAAACAAACTGGCCATCAATGATCTTGCCAAGG
ACTTAATCGAAAAATCACAACAATTATTGCAGATCCTTTTGTTAAGCAGCAAGTGCCTTTTGATCAAACT
CATTATCCTATTCGCTGCCCTGCCCTTATTTGCTTTAACCATGATTGCAGGTCTGGTTGACGGCCTAAAT
CAAAGAGCAATACGTACCGCTTGTTTAGGTCGTGAATCCTCTTATGTGTTCCACAGGCTTAATCACTATT
TGAAAAAAGGACTGGTGATTTTACTCATACTGTGGCTTGCCCTGCCCGTTAGCATCACCCCTGCTTATGT
CTTTGTACCTGTCAGTTTGTTGATGGGATTAATGGTAGCCATGACGGCCAGCCGCTTTAAGAAATACTTA
TAG
 Primer design