SecReT4
Protein ID: 52842291
T4SS name [ID]Tra_F [540]
Gene symbol-
Locus taglpg2077
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2319208..2325153 [-]
Producthypothetical protein
Component typeTraI_F
UniProt IDQ5ZTT4
KEGG IDlpn:lpg2077
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 1.8e-81, Aligned region: 7..295
AAA_30 [PF13604], Evalue: 1.3e-44, Aligned region: 448..630
Toprim_3 [PF13362], Evalue: 2.5e-17, Aligned region: 1781..1882
Protein Sequence: 1981 a.a.     [Download]
>gi|52842291|ref|YP_096090.1| hypothetical protein lpg2077 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MLSLQPLDSADGAAAYYLDVVNYYENDSKSVRWLGDGAKILGIHGQAVEKEQMIALLKGILPDGTQLGRI
DKDGIHHRPGFDMTLTAPKSFSILLESGADPRLGEVFDKAVEWFVEEMEKEFAQARQLVDGKIEYIDTRN
LVIAAFRQPSSRANDPNSHTHLVVQNMTHCPDGKWRSLASDMDGQKGVVEQIMKHHIYGGLKFRNKLANL
TKELGYQLASDGDGLWEIQGAPEQVLTHFSKRRESIEALLDEKGWSGAKASSIAAQKTKLDKEIIDYEKW
KEDIIKECQEMGFDPHQLVASSYKPQKNLFQTLKENIVERFYGKDNIEMTHARESVYVAIESISQQHAVF
EERELKKEALKYVIASNKIIDETLINKAIDENIANQNLYTARHPFTQKPLLTTPWQLTLESEAIQRIENG
KGAVSAICSKQKVSEFIKAKEQEMAFALSPSQKKAMTTFLTSTDRFIAIQGYAGTGKTTMLRLTRELASL
QGYEIRGITAGSAAANELRHKGGLNASTFARELGRLQNQKQDLSKTIFVVDEASMLSNPQGHKIIKLAEQ
FNTQLKIIGDKAQLPSPSSGKLFSVIQDYGIKTVAMTDNLRQKDSELRESAIHAGRGEIYDAVDKLTHVE
TLDTYLKRVDYISSKWLSLTPEERQNTLCFAPTHRNRQDITQILRNALIQEGTLTGQEHLQPILKERNLT
GIKLRNAAYYSQNDIIRFNHTIQRYNIKAGDYLTVGQVTNKNKHNNTLILKHENGQAIKFKLSSLPEFRT
ENKDLERPVEVYRREQLSLMAGDQIQWKRNSEHNGIRNSELATIRQINNEGITIITEDNQTLHLPHGAKE
LRHLDHGYVLTTYATQGKDKKRGLGLIESQNRFASTIQNYYVETTRGIWEMIVVTDDKDHLVKAITTNNS
DKYSSMDMVDSDTLKAHEARFKEHKNSIVLQNAIEKKLSKEQDWKGLEQTVETYVQCKQQGEDRKAAKLA
FAIVNDPKLYRLAKERLGFGVSTYRREALRFQTSKLLHSLPKSERQDFSTVRQYVFLNQQILKRSQHINA
QSLDNGISNQNKQALQQQSAKRNAVAFVISRDLERYKPYLQHFSIGELNRIGLPQHEYGKEFKKAQMRLE
SLGKQATRDLIRTNISLYLNAQGEEKERLAVQIKRESKLSHSFVLTHAKELNQKPESLWQSIHKDARLHS
DKLFRNGLSAEGRLAFDNIKAYKALQLELRENWSASLKEAGNSEGKSSNPKSIELLTRRNELAHELMQNK
AMPEIASYFKLDLAKLAVQTEKQQYRENIKQFTASKSNFKTRLAVINEIKNDITGHYPFIKEANIESKTL
SKYLRVTDRKERLSNISSPEKKDYQCFLTYKKASMQTYRLWQQAHLNKADGNVQNNKLISAAISQSSKRD
ALAHQLKGSKYLDSILSYEKGNKEKLLAQASNHQIKLREIKELNEVVHTLSMQFPSVTNSNSAKEISAWK
KNWLSLSSHMKQIEKGSGYQLALQEYPLNVSSVNTINKELENNYDFKPETITQKSLQSTNPVLQKIQQSA
QFLDARIINEALMADPETTYKTIWGEPKTQNSRELRYSGGLIVSLKGKDKGLWHDFSDGIGGAPIQAIIA
RDKLSFKEALSQAASMVGINQLENLSIFIKAPISSKNELQKLNDLEKKNKVISAKSIWDGSILAKGTLAE
KYLKQHRGIESIDKMDIRFWPTGSQWKNCNEQGLLEDKVNKIPALIIAARNEKNELTGVQRIYLDKQTAS
KNKFMDNPKLSKGIIDGSCGVIQKGMQGSRLYIAEGFETGASIALADSKATVLCSFGVSNMKNLSPIIKK
FHSKEVVIAGDNDGEFAKSQQAIEKTINAFKQDNLSARAVFPDGLQGKAKTDWNDIHLSKGIAEIQKQLM
RKDIGAISSIVDKPIELPKTIADFVQIKSMKLSGSQIISIRDNAATIDNKRDLNQLVAAYNKSQQALEKS
GSFTPEKTLPTKTRSEIEMDR
 
Nucleotide Sequence: 5946 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2325153-2319208 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
ATGTTAAGTCTTCAGCCATTAGACAGTGCCGATGGAGCCGCAGCCTACTATCTAGATGTCGTCAATTATT
ATGAAAACGATTCTAAAAGTGTTCGTTGGTTAGGAGATGGAGCGAAAATTCTTGGGATCCACGGGCAAGC
AGTAGAAAAAGAACAGATGATTGCCCTTCTGAAAGGCATATTACCTGATGGTACTCAACTCGGTCGAATC
GATAAGGATGGTATTCATCATCGCCCCGGTTTTGATATGACCCTTACTGCCCCAAAGTCTTTTTCAATTT
TACTTGAAAGTGGTGCTGATCCAAGGCTTGGAGAGGTGTTTGATAAGGCCGTAGAATGGTTCGTTGAAGA
AATGGAAAAGGAGTTTGCACAAGCCAGGCAACTTGTTGACGGCAAAATTGAATATATTGATACCAGAAAT
TTAGTCATTGCAGCATTTCGTCAACCAAGCTCTCGTGCCAATGATCCTAATTCACATACGCACCTTGTAG
TTCAAAATATGACCCACTGCCCAGATGGGAAGTGGCGCTCGCTTGCCAGTGACATGGATGGTCAAAAAGG
CGTGGTTGAACAAATCATGAAGCACCATATCTATGGCGGGCTTAAATTTCGTAACAAATTAGCGAATTTA
ACCAAAGAACTTGGCTATCAGCTGGCATCTGATGGTGATGGTTTGTGGGAAATCCAGGGTGCACCTGAGC
AGGTATTAACTCATTTTTCAAAAAGAAGGGAATCCATCGAAGCATTACTTGACGAAAAAGGCTGGAGTGG
TGCTAAAGCATCCTCGATTGCGGCTCAAAAAACAAAATTGGATAAAGAAATCATTGATTATGAGAAATGG
AAAGAAGACATCATCAAAGAATGCCAGGAAATGGGCTTTGATCCACATCAACTAGTGGCTTCATCGTATA
AGCCTCAGAAAAATCTCTTTCAAACTTTAAAGGAAAACATTGTTGAGCGCTTTTATGGTAAGGATAACAT
CGAAATGACTCATGCCAGAGAGTCTGTGTATGTGGCCATTGAATCAATCAGTCAACAGCATGCGGTGTTT
GAGGAAAGGGAACTTAAAAAAGAAGCGCTAAAATATGTAATCGCCAGCAATAAGATAATCGATGAAACCT
TAATTAATAAAGCCATTGATGAAAACATTGCAAATCAAAACCTGTATACGGCAAGACACCCCTTCACACA
AAAGCCTTTATTGACAACGCCCTGGCAACTAACACTTGAGAGCGAGGCCATCCAGCGTATTGAAAATGGT
AAAGGTGCTGTTTCTGCTATTTGTTCGAAACAAAAAGTCAGTGAGTTTATAAAAGCAAAAGAACAGGAGA
TGGCATTTGCTTTATCCCCTTCACAGAAAAAAGCTATGACAACCTTCCTAACCTCAACAGACCGATTTAT
TGCCATTCAAGGGTATGCAGGAACTGGTAAAACCACGATGCTACGTTTGACTCGTGAATTAGCATCTCTT
CAGGGCTATGAAATTCGTGGTATTACCGCAGGCTCGGCAGCCGCCAATGAACTGCGCCATAAAGGAGGGT
TAAATGCTTCTACCTTTGCAAGAGAGTTAGGGAGATTGCAAAATCAGAAACAGGACTTAAGTAAAACCAT
ATTTGTGGTGGACGAAGCCTCTATGTTATCTAATCCACAAGGACATAAAATCATCAAACTGGCAGAACAG
TTTAATACCCAGTTAAAGATCATTGGCGATAAAGCCCAGCTTCCTTCCCCATCCAGCGGGAAATTATTCT
CTGTCATTCAAGATTATGGGATTAAAACCGTTGCCATGACGGATAATCTTCGCCAGAAAGACTCAGAATT
AAGGGAATCAGCAATTCATGCTGGTAGAGGTGAAATCTATGATGCCGTTGATAAGTTAACTCATGTGGAA
ACGCTTGATACTTATTTAAAACGGGTTGATTATATTTCAAGTAAATGGTTGTCATTAACACCAGAAGAAC
GCCAAAACACACTATGCTTTGCCCCAACGCACAGAAATCGCCAGGATATAACTCAGATTTTACGAAACGC
TTTAATTCAAGAAGGGACACTAACCGGACAAGAGCATCTGCAACCCATATTAAAAGAACGCAATTTAACT
GGAATTAAGCTCAGAAATGCAGCTTATTATAGTCAAAACGATATCATTCGTTTTAATCATACTATTCAGC
GGTATAACATCAAAGCAGGAGATTATTTAACTGTTGGGCAGGTCACTAACAAAAACAAGCATAATAATAC
ACTGATTCTTAAGCATGAAAATGGTCAAGCCATAAAATTTAAATTGTCCTCACTACCTGAATTTAGAACT
GAAAACAAAGATTTGGAACGGCCTGTTGAAGTATATCGGCGAGAACAATTGAGTCTAATGGCCGGTGATC
AAATTCAATGGAAACGTAATTCTGAACACAATGGTATTCGCAACTCTGAATTGGCAACCATCAGACAAAT
CAACAATGAGGGAATAACAATCATAACGGAAGACAATCAAACCCTACACTTACCTCACGGAGCAAAAGAA
CTACGACATCTTGATCATGGCTATGTACTCACGACCTATGCTACCCAGGGAAAAGATAAAAAAAGAGGTC
TTGGCCTTATTGAAAGCCAAAACCGATTTGCATCAACCATCCAAAACTATTACGTGGAAACAACCCGTGG
TATTTGGGAAATGATAGTAGTCACGGACGATAAAGATCATCTGGTTAAAGCCATTACCACCAATAACAGT
GACAAGTACTCCTCAATGGATATGGTTGATTCAGATACTCTGAAAGCTCATGAAGCACGTTTTAAAGAGC
ACAAAAACAGCATAGTCTTACAAAATGCCATTGAAAAAAAATTATCGAAAGAACAGGACTGGAAGGGCTT
GGAACAGACAGTAGAAACCTATGTTCAATGCAAACAACAAGGGGAAGATCGAAAAGCGGCAAAATTAGCA
TTTGCCATTGTGAATGATCCCAAATTGTATCGCCTTGCCAAAGAACGCTTGGGTTTTGGTGTTAGTACCT
ATCGGCGTGAAGCCCTGCGTTTCCAAACCTCGAAGTTATTACATTCACTACCCAAATCAGAAAGGCAGGA
TTTTTCTACTGTCAGGCAGTACGTGTTTTTAAACCAACAAATCCTTAAACGAAGTCAGCATATCAATGCC
CAATCGTTGGATAATGGAATTTCAAATCAGAATAAACAAGCTCTGCAACAACAGTCCGCTAAACGCAATG
CAGTAGCTTTTGTAATTAGTAGGGATCTGGAGCGTTATAAACCTTATTTGCAGCATTTTTCCATCGGAGA
ACTAAACCGAATTGGATTGCCACAGCATGAATATGGCAAGGAATTTAAAAAAGCACAGATGCGCCTGGAA
TCACTTGGCAAGCAGGCAACAAGGGACTTAATACGTACCAATATTTCGCTTTATTTAAACGCACAAGGCG
AAGAGAAAGAAAGGCTTGCAGTCCAAATTAAAAGAGAATCCAAGTTATCACATTCTTTTGTTTTAACCCA
TGCAAAAGAATTGAATCAAAAGCCTGAATCATTATGGCAATCCATACATAAAGATGCGCGTTTGCATAGC
GATAAATTGTTTCGAAATGGATTAAGTGCTGAGGGAAGATTGGCGTTCGATAACATCAAAGCCTATAAAG
CATTACAGCTTGAGCTTAGAGAAAATTGGTCAGCAAGTTTAAAAGAAGCGGGAAACAGTGAAGGGAAGAG
TAGTAATCCAAAATCTATTGAGTTACTCACCCGCCGCAATGAGTTAGCTCACGAATTGATGCAAAACAAA
GCCATGCCTGAAATAGCCTCTTATTTCAAGCTGGATTTGGCAAAGTTAGCAGTACAAACAGAAAAACAGC
AGTATCGGGAAAACATCAAGCAATTTACGGCAAGTAAGTCTAATTTCAAAACACGTCTTGCAGTAATTAA
TGAGATTAAAAATGATATCACTGGCCATTATCCCTTTATTAAAGAAGCAAATATTGAATCTAAAACCCTT
AGTAAATATCTACGAGTTACCGACAGAAAGGAACGATTATCTAATATTTCTTCACCTGAGAAAAAAGACT
ATCAATGTTTCCTGACTTACAAAAAAGCCAGTATGCAAACTTACAGGCTTTGGCAGCAGGCGCACCTTAA
TAAAGCTGATGGCAATGTACAAAATAACAAGCTGATATCAGCAGCAATCAGTCAGTCATCAAAACGTGAT
GCATTGGCTCATCAATTAAAAGGCTCAAAGTACCTTGATTCAATTTTATCCTATGAAAAAGGCAACAAAG
AAAAGCTGTTAGCCCAGGCTAGCAACCACCAAATAAAATTGCGTGAAATTAAGGAGCTAAATGAAGTCGT
ACACACACTATCAATGCAGTTCCCTAGCGTCACAAACTCTAATTCTGCAAAAGAAATATCAGCCTGGAAA
AAGAACTGGTTATCTCTTTCCAGTCATATGAAGCAAATTGAAAAGGGCAGCGGTTATCAATTAGCTTTGC
AAGAATATCCATTGAATGTGTCATCTGTAAATACAATTAATAAGGAATTAGAAAATAACTACGATTTTAA
GCCAGAAACGATCACCCAAAAATCATTGCAATCAACCAATCCGGTCTTACAAAAAATCCAACAATCTGCA
CAATTTTTGGATGCCAGAATTATTAATGAAGCTCTGATGGCCGACCCAGAAACTACCTATAAAACAATCT
GGGGTGAGCCAAAAACACAAAACTCCAGAGAGTTACGTTATTCTGGTGGCTTAATTGTAAGCTTGAAAGG
CAAGGACAAAGGCTTATGGCATGATTTCAGTGACGGAATAGGAGGCGCGCCGATTCAAGCGATTATTGCT
AGAGATAAGCTGTCCTTTAAAGAAGCACTCTCTCAAGCTGCGTCCATGGTAGGCATAAATCAATTAGAAA
ACCTTTCCATATTCATAAAAGCCCCCATTTCCAGTAAAAATGAATTACAAAAATTAAATGACCTTGAAAA
GAAGAACAAAGTAATTTCTGCAAAAAGTATCTGGGATGGTTCTATTCTTGCAAAGGGAACATTGGCCGAA
AAATATTTAAAACAACATCGGGGCATAGAATCCATTGATAAAATGGATATACGTTTCTGGCCCACTGGAT
CTCAATGGAAAAACTGCAATGAACAAGGATTATTGGAAGATAAAGTTAATAAAATCCCAGCATTAATCAT
TGCTGCAAGAAATGAAAAAAATGAACTAACAGGCGTTCAACGAATTTATCTGGACAAGCAAACAGCCAGT
AAAAATAAATTCATGGACAACCCAAAGCTATCCAAAGGAATCATAGACGGCAGTTGTGGCGTTATTCAAA
AAGGAATGCAAGGATCCCGCCTTTATATCGCCGAAGGTTTTGAAACAGGTGCTTCCATCGCTCTCGCGGA
CAGCAAAGCCACAGTTTTATGCTCCTTTGGCGTTTCAAACATGAAGAACTTAAGCCCAATCATCAAAAAA
TTCCATTCAAAAGAAGTTGTTATTGCAGGAGATAATGATGGAGAGTTCGCTAAATCACAACAAGCCATCG
AAAAAACAATTAATGCCTTTAAACAAGATAACTTAAGTGCCAGAGCAGTATTTCCCGATGGGTTGCAGGG
AAAAGCAAAAACAGACTGGAACGATATTCATTTAAGCAAAGGGATTGCAGAAATCCAAAAGCAACTAATG
AGAAAGGATATAGGAGCCATTTCCTCAATCGTTGATAAGCCAATTGAACTACCAAAAACAATTGCCGATT
TTGTACAAATAAAGTCCATGAAGTTAAGCGGCAGCCAAATCATTTCCATTAGAGACAATGCTGCAACCAT
TGACAATAAAAGAGACTTAAATCAATTAGTCGCAGCTTACAACAAAAGTCAACAAGCATTAGAAAAATCT
GGCTCCTTCACTCCTGAAAAAACACTGCCCACAAAAACAAGGAGTGAAATAGAAATGGATCGTTAG
 Primer design