SecReT4
Protein ID: 52842292
T4SS name [ID]Tra_F [540]
Gene symbol-
Locus taglpg2078
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2325174..2327066 [-]
Producthypothetical protein
Component typeTraD_F
UniProt IDQ5ZTT3
KEGG IDlpn:lpg2078
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.7e-147, Aligned region: 170..554
T4SS-DNA_transf [PF02534], Evalue: 1e-20, Aligned region: 143..568
TraG-D_C [PF12696], Evalue: 3.2e-17, Aligned region: 413..533
AAA_10 [PF12846], Evalue: 2.2e-13, Aligned region: 185..231
AAA_10 [PF12846], Evalue: 2.2e-13, Aligned region: 409..488
Protein Sequence: 630 a.a.     [Download]
>gi|52842292|ref|YP_096091.1| hypothetical protein lpg2078 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MMAVNPTKLFIRGGQIFLHNVRMFTQVGKKVSLAMLIVFFIFSVIAFYFNTSAYQRYIGQQWVKAQAMTL
IQSKAKQVVRMPTGESYPVYSAQIVKAPMVIGIVNQLKQALLKSMIEALFASVMMLIVMVKWLQKRGENQ
SKAKIIRGSELVDENTLQKCIKKTSRISPYRIGGVSLPFGSETQHIQIVGTTGSGKTVAIRDLLTTIQAR
GERAIIYDKGGTYLSRFYREHQDVILNPLDTRGHSWNVWAECEDKADLEALAEAIMPMPINNTMDPFWIK
AARMIFVSTANELKNDPKRSNLMLLQYLLTADLGRIHHLLRHTESESLVSDKVQKTALNVKTVMATYLKS
LLYLKDDGDIFSIRDWILNEQNNSCLFVSSDGRKHPTIRPLISAWINTATKELLSLAPDDNRRVWFILDE
LATLHALPFLAAVKSESRKFGGCFLLGHHGASQLRTIYGNDGAASLSNLCSTRLFLRLPEHTDAEHASRN
IGTYEIEEVNESISYGANTMRDGISVSRQTKEKQLVLPTQIQVINDLQGYLRVKGEFPAAKIKLNYVDYP
LIHEEFIARDIDPDPLRQKVEQLVDTYSDPILAASHDDALEAATSTKKDITKPIAREKKLEEEKELVEFL
 
Nucleotide Sequence: 1893 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2327066-2325174 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
ATGATGGCGGTAAATCCTACAAAATTATTTATTCGCGGCGGTCAAATCTTTTTGCACAATGTCCGCATGT
TCACACAGGTAGGTAAGAAAGTAAGCCTTGCTATGCTGATAGTTTTTTTTATTTTCTCAGTCATCGCTTT
TTATTTTAATACCAGTGCGTATCAACGTTATATTGGCCAGCAATGGGTTAAAGCCCAGGCAATGACTTTA
ATACAGAGCAAAGCCAAGCAAGTGGTTCGCATGCCAACGGGTGAATCTTATCCAGTGTATTCAGCGCAAA
TTGTAAAAGCTCCCATGGTCATCGGCATTGTTAATCAATTAAAACAAGCTCTACTTAAGAGCATGATAGA
GGCACTATTTGCCTCTGTCATGATGTTAATTGTCATGGTTAAGTGGTTGCAAAAAAGAGGGGAAAATCAA
AGTAAAGCTAAGATCATTCGCGGCAGTGAGTTAGTTGATGAAAACACGTTACAAAAGTGCATCAAAAAGA
CAAGCAGGATTTCTCCTTATCGGATTGGTGGTGTATCTCTGCCCTTTGGTTCTGAAACCCAGCATATACA
AATAGTCGGAACCACCGGATCTGGTAAAACTGTTGCTATTCGTGATCTATTGACGACAATACAAGCTAGG
GGTGAGCGCGCGATTATTTATGATAAAGGAGGAACTTATTTATCCCGTTTTTATCGTGAACATCAAGATG
TAATTTTAAATCCCTTAGATACGAGAGGCCATTCCTGGAATGTCTGGGCAGAATGCGAAGACAAAGCAGA
TCTTGAAGCACTTGCTGAGGCCATCATGCCGATGCCCATCAATAACACCATGGATCCCTTTTGGATTAAA
GCCGCGCGTATGATTTTCGTCTCGACTGCCAATGAGCTAAAAAATGATCCTAAACGCTCCAATCTGATGT
TATTGCAATATTTGCTCACAGCAGACTTAGGTCGAATTCATCATTTACTGCGTCATACTGAATCAGAATC
TCTGGTATCCGATAAAGTACAAAAGACTGCTTTAAATGTGAAAACCGTAATGGCTACTTATTTAAAATCC
TTACTGTATTTGAAAGATGATGGGGACATCTTTTCGATTCGCGACTGGATTTTGAATGAGCAGAATAATT
CCTGTTTGTTTGTCAGTTCTGATGGGCGCAAACACCCAACCATCAGACCACTAATTTCGGCCTGGATTAA
TACTGCTACCAAAGAACTCTTAAGTTTAGCGCCTGATGATAACCGCCGTGTTTGGTTTATTTTGGATGAG
CTGGCTACCTTGCATGCCTTACCTTTTTTAGCCGCAGTTAAATCAGAAAGTCGCAAATTTGGTGGTTGCT
TCTTATTAGGTCATCACGGTGCATCCCAGTTGCGTACCATTTATGGTAACGATGGTGCCGCGTCCCTTTC
AAATCTGTGTTCGACTCGATTGTTCCTACGCTTACCCGAACATACTGATGCGGAGCACGCCTCCCGCAAT
ATTGGTACATACGAAATTGAAGAGGTGAATGAGTCCATCAGTTATGGGGCAAACACCATGCGTGATGGGA
TTTCAGTTTCTCGTCAAACTAAAGAAAAACAATTGGTTTTACCAACCCAAATTCAGGTAATCAATGATCT
ACAAGGATATTTGCGCGTCAAAGGGGAATTTCCTGCGGCAAAAATAAAGCTTAATTACGTTGATTATCCT
CTCATTCATGAAGAATTTATTGCACGAGACATTGATCCTGATCCACTTCGTCAAAAAGTAGAGCAATTGG
TGGACACCTACAGCGATCCCATCCTTGCCGCATCCCATGATGATGCTTTAGAGGCTGCAACTTCAACAAA
AAAAGATATCACAAAACCAATTGCAAGAGAAAAAAAGCTTGAGGAAGAAAAAGAGCTTGTTGAGTTTTTA
TAA
 Primer design