SecReT4
Protein ID: 52842293
T4SS name [ID]Tra_F [540]
Gene symboltraG
Locus taglpg2079
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2327599..2330328 [-]
Producthypothetical protein
Component typeTraG_F
UniProt IDQ5ZTT2
KEGG IDlpn:lpg2079
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.7e-106, Aligned region: 10..458
Protein Sequence: 909 a.a.     [Download]
>gi|52842293|ref|YP_096092.1| hypothetical protein lpg2079 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MSEMAVTMQIYTITGGELLKAFYNATAAMFHYDGILGIFRTALIIGGVWTVGQFIVKRDVRSMFFFILKY
AFVISFILTPTCNLQIHDRTDPLRPDLTVDNVPLVLGVVGGLSSQLSDKITRLFEFFFHSPNDMDYSQTG
MIMGAKLFLSASNIKITDPLFNANMQKFMQQCVFYDVMYGRYGLKDINQARDIWELVKSNASVARGFIYD
GSFKSCMEAASLLDSAWSGVIEDAKSKYAGFAFGNHSDALANFEKYLPQAYNHLTAMSGDAAALIRQNMM
ANAIRDGVFSMGARVNSKAAIDSFSASRAQDKIPAALSNIGLMSAYWLPMLQSLLFCIVIGCFIFVLFFF
PFPSGISFFQFYATLYVWLALWAPMFTVINYIMTILAQFSLSFVSTGATTLAYQTGMNQVYENMAALGGY
LVLATTTLSYMLISRHVGSFVSLTQQPTGIVQNAASSAAEEAQMGNYSYGNTSFANHNGFNSSSFHNDQN
ARISLGGIETSLDSGSIARISRDGSETLTMATATSHTPLNIQLGESTRSAFSELSDSAKSAGFNKSIASS
EHYAASLRSLAELGETQSHGEQSGQGHQISTSAGFNAAASKISNLIDTFAHDHNISRDDATKVLSAASIN
LGGSFGFGTGSAVPGAKGNIEIGGNVRHERDKSESHQDARLMNEARRFSEEHHFTDVVNEARQATKDDHF
RTSDDFSGRLANNFSAGFDKSMQYRDEAVASFSESESYHRQATTSSEQTASINLDAQTGFIDWLSHHRAP
NSQGTIGLQQAEWLIRHDPELAQSYARQFVGEKTAQSISQFQKNHPINESQVHQKNEGFKSRIAGSAGVD
HALGDYTNTFNDRAKNINAGSVNKDSVSAVDKDFARAKSEMSKNVEGIVQDGSQVMQDVIVAQANKDVK
 
Nucleotide Sequence: 2730 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2330328-2327599 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
GTGAGTGAAATGGCTGTTACGATGCAAATTTATACGATTACCGGTGGTGAGTTACTTAAGGCGTTTTATA
ACGCCACCGCAGCTATGTTTCACTATGATGGAATACTTGGGATTTTTAGAACAGCACTGATTATTGGTGG
GGTTTGGACTGTTGGCCAATTTATTGTAAAACGTGATGTGCGCAGTATGTTCTTCTTTATTTTAAAATAT
GCTTTTGTTATTTCATTTATTCTAACACCTACCTGCAATTTGCAAATCCACGATAGAACTGATCCTCTGC
GACCAGATTTAACGGTTGATAACGTGCCCTTAGTTTTGGGTGTTGTAGGAGGATTAAGCAGTCAGCTAAG
TGATAAAATAACCCGGCTTTTTGAATTCTTCTTTCATTCACCTAACGATATGGATTACAGCCAAACAGGC
ATGATCATGGGTGCGAAGCTCTTTTTATCAGCAAGTAATATAAAAATAACCGATCCGTTGTTTAATGCAA
ACATGCAAAAGTTCATGCAGCAATGCGTGTTCTATGATGTGATGTATGGACGATATGGCTTAAAAGACAT
TAATCAAGCAAGAGATATTTGGGAATTGGTTAAATCCAATGCCTCTGTTGCTCGTGGGTTTATTTACGAT
GGTTCATTTAAATCGTGTATGGAAGCCGCTAGTTTATTAGACAGTGCCTGGAGTGGCGTGATTGAAGATG
CCAAATCTAAGTATGCAGGTTTTGCTTTTGGCAATCATTCAGATGCCCTAGCTAATTTCGAAAAATACTT
ACCTCAAGCTTATAATCATTTAACCGCCATGTCAGGTGATGCCGCAGCACTTATTCGGCAAAATATGATG
GCCAACGCCATTCGCGATGGCGTGTTTTCTATGGGCGCACGTGTGAATTCAAAAGCGGCCATAGACAGTT
TTTCAGCCAGTCGAGCACAGGATAAAATACCCGCGGCACTCAGCAACATTGGACTAATGTCCGCCTATTG
GTTGCCCATGTTGCAAAGTCTTTTATTTTGCATTGTTATAGGGTGTTTTATTTTTGTCTTGTTTTTTTTC
CCCTTTCCCTCCGGCATTTCTTTTTTTCAATTTTACGCAACACTGTATGTCTGGCTTGCCCTATGGGCAC
CGATGTTTACTGTTATTAACTACATCATGACTATTTTGGCGCAGTTTTCATTGTCCTTTGTGTCAACAGG
GGCGACTACTTTGGCCTACCAAACAGGCATGAATCAAGTCTATGAAAATATGGCTGCCTTGGGAGGCTAC
TTAGTCTTGGCGACAACCACATTGAGTTATATGTTAATCAGTCGACACGTGGGTAGTTTTGTATCACTCA
CGCAACAACCAACAGGTATTGTTCAAAATGCCGCCTCCTCTGCGGCAGAAGAAGCACAAATGGGAAATTA
CAGCTACGGAAATACCAGTTTTGCTAATCATAATGGGTTTAATAGCAGTTCTTTTCATAACGATCAAAAC
GCCAGAATATCATTGGGTGGTATTGAAACAAGCCTTGATAGTGGTTCAATTGCGCGAATATCGCGTGATG
GCAGTGAAACACTGACGATGGCAACTGCGACCTCGCATACCCCGCTTAATATTCAATTAGGAGAAAGCAC
GCGATCTGCATTTTCTGAATTATCCGACAGTGCTAAAAGTGCTGGGTTCAATAAATCAATTGCTTCATCA
GAGCACTATGCGGCATCACTCAGAAGCCTGGCAGAGCTTGGTGAAACGCAATCACATGGGGAACAAAGTG
GGCAGGGACACCAAATATCCACTTCAGCAGGCTTTAATGCGGCGGCATCAAAAATATCCAATCTCATTGA
TACCTTTGCTCACGATCATAATATTTCTCGGGATGACGCGACTAAAGTTTTAAGTGCTGCCAGTATTAAT
TTAGGAGGATCGTTTGGTTTTGGAACCGGTTCTGCAGTACCTGGGGCAAAGGGTAATATTGAGATTGGGG
GAAATGTGCGTCATGAACGGGACAAATCAGAATCCCATCAAGACGCACGCTTGATGAATGAAGCGCGGCG
CTTTAGTGAGGAACACCATTTTACAGATGTGGTGAATGAGGCAAGACAAGCCACCAAGGACGATCATTTC
CGCACTTCTGATGATTTTAGTGGACGCTTGGCTAATAACTTTTCAGCAGGCTTTGATAAATCTATGCAGT
ATCGAGATGAAGCTGTGGCGAGTTTTTCCGAATCAGAGAGTTATCACCGACAAGCAACTACTTCCAGCGA
ACAAACAGCATCTATTAATCTTGATGCTCAAACAGGATTTATTGATTGGTTATCACATCATCGTGCACCT
AATAGTCAGGGCACTATTGGGTTGCAACAGGCAGAATGGCTAATTCGTCACGATCCTGAATTAGCTCAGT
CTTATGCAAGACAATTTGTTGGTGAAAAAACCGCGCAATCAATCAGCCAATTTCAAAAAAATCATCCTAT
TAACGAAAGTCAAGTGCACCAAAAAAATGAAGGATTTAAAAGTCGTATTGCAGGTAGTGCGGGGGTTGAT
CATGCCCTTGGGGATTATACCAATACGTTCAATGACCGAGCAAAGAACATCAATGCAGGAAGCGTCAATA
AAGATTCGGTTAGTGCAGTTGATAAGGATTTTGCACGCGCCAAGTCAGAGATGTCCAAGAATGTTGAGGG
CATAGTGCAAGACGGGTCGCAAGTCATGCAGGATGTCATCGTTGCCCAGGCAAACAAGGACGTAAAATGA
 Primer design