SecReT4
Protein ID: 52842294
T4SS name [ID]Tra_F [540]
Gene symboltraH
Locus taglpg2080
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2330325..2331710 [-]
Producthypothetical protein
Component typeTraH_F
UniProt IDQ5ZTT1
KEGG IDlpn:lpg2080
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.3e-109, Aligned region: 30..381
Protein Sequence: 461 a.a.     [Download]
>gi|52842294|ref|YP_096093.1| hypothetical protein lpg2080 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MKKILLSCGLIGALGIGQVYSKSIGEDLTGYFKALNMGANVTEPHAYQAQRAGFYTGGNLYARSSVRNLQ
IMRLSWPKVSAGCGGIDATLGGFSHIKGKEFVDFTKNILNNSQGLAFQLALEQATPLLGNVATKLQNVAT
WVNQTNISSCATAESAVLGLAPRTRIAQQHACQSIGQSKNLFSDWAEARQGCGKGSSNYDYDRVINENSS
NEQVVDNTNVAWNALKKNGLFADDIELAQLMMTLSGTLILTRDAEGVHVQRLSSLVSNNNLISALLRGGE
VKIYQCDEKVKCLQPTLTSKNIDISHGLESKVRDLILDMASKIKDNVEQSEAAKGLIESTQYPVMKMVSV
QMAFMKDSAVIDTTRYSEAIAIDILFQYLNENLQLVKQAAGALQYPEAIMKEFQTDLTQARRDLVQMEGS
AHQRMSMAMQMIQETQTIEQMLVGEFSSELTQSLSWANQMR
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2331710-2330325 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
ATGAAAAAAATTCTTCTGTCTTGTGGGTTAATCGGTGCACTTGGCATCGGACAAGTGTACAGCAAATCAA
TAGGTGAGGATTTAACTGGTTATTTTAAAGCTCTTAATATGGGCGCGAATGTAACAGAGCCGCATGCTTA
CCAAGCGCAGCGTGCTGGTTTTTATACTGGCGGTAATTTATACGCTAGAAGCAGCGTACGTAATCTGCAA
ATCATGCGTTTGAGCTGGCCTAAAGTGTCCGCAGGCTGTGGCGGCATAGATGCCACGTTAGGTGGGTTTT
CTCACATCAAAGGTAAAGAATTTGTCGATTTTACCAAGAATATATTGAACAACTCACAAGGTCTTGCCTT
CCAATTGGCCCTAGAGCAAGCAACTCCTCTTTTAGGTAATGTGGCAACCAAATTACAAAACGTGGCTACC
TGGGTGAACCAAACCAATATCAGCTCGTGCGCAACCGCGGAAAGTGCCGTACTGGGTTTAGCCCCACGCA
CCCGTATTGCACAACAACATGCCTGCCAATCCATCGGTCAATCCAAAAATCTCTTTTCAGACTGGGCCGA
GGCACGACAAGGCTGTGGTAAAGGCTCCAGTAATTATGATTACGACAGAGTGATTAATGAAAACAGCAGC
AATGAGCAGGTAGTTGATAATACCAATGTGGCGTGGAATGCGTTAAAGAAAAACGGCTTATTTGCAGATG
ATATCGAATTAGCTCAACTCATGATGACCTTATCAGGCACCTTAATTCTGACTCGCGATGCAGAAGGGGT
GCATGTCCAACGCCTGTCTTCCTTAGTAAGTAATAACAATTTAATCAGCGCTCTTTTACGCGGTGGCGAG
GTAAAAATCTATCAATGTGATGAAAAGGTCAAATGCTTACAACCCACCTTAACCAGTAAAAACATTGATA
TCAGTCATGGTCTTGAATCAAAAGTTCGTGATCTGATTTTGGATATGGCAAGCAAGATTAAAGACAATGT
GGAGCAAAGTGAGGCCGCTAAAGGATTAATTGAGTCCACACAATATCCGGTGATGAAAATGGTCAGCGTT
CAAATGGCCTTTATGAAGGACAGTGCAGTGATTGACACTACACGTTACTCAGAAGCCATTGCCATCGATA
TTTTATTTCAATATTTGAATGAAAACCTGCAACTCGTTAAACAAGCAGCAGGAGCTCTGCAATATCCAGA
AGCAATAATGAAAGAGTTTCAAACTGATCTCACCCAGGCTCGTCGCGACTTGGTTCAAATGGAAGGTAGC
GCGCATCAGCGAATGAGCATGGCGATGCAGATGATTCAAGAAACTCAAACCATCGAGCAAATGCTTGTAG
GCGAATTTTCATCAGAGCTCACTCAGTCTTTGAGTTGGGCTAATCAAATGAGGTGA
 Primer design