SecReT4
Protein ID: 52842295
T4SS name [ID]Tra_F [540]
Gene symboltraF
Locus taglpg2081
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2331707..2332129 [-]
Productsex pilus assembly TraF, thiol-disulfide isomerase and thioredoxins
Component typeTraF_F
UniProt IDQ5ZTT0
KEGG IDlpn:lpg2081
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 7.7e-30, Aligned region: 26..128
Thioredoxin_8 [PF13905], Evalue: 1e-07, Aligned region: 38..73
Thioredoxin [PF00085], Evalue: 4e-07, Aligned region: 40..125
Protein Sequence: 140 a.a.     [Download]
>gi|52842295|ref|YP_096094.1| sex pilus assembly TraF, thiol-disulfide isomerase and thioredoxins [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MRNKLAIFLILGTLFSSSLYADIDNAPLHALAKHQGFFFFFSSSCPHCQRFAPTLKRLSQHYGFSVVAIS
VDGGFLPSFPDAVMNEGQTKVFQVSVYPSLFLINPKSQVASLVTEGTIDEGELTNRLLKISQIHDKEVPL
 
Nucleotide Sequence: 423 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2332129-2331707 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
ATGCGCAATAAATTAGCTATTTTTCTAATATTAGGAACGTTATTTTCATCAAGCCTATACGCCGATATTG
ATAATGCACCGCTTCATGCCCTTGCCAAACATCAAGGATTTTTCTTTTTTTTCAGTTCGAGTTGTCCTCA
TTGTCAACGCTTTGCACCCACGCTCAAACGCTTGAGTCAACACTATGGCTTTAGCGTAGTTGCTATTTCT
GTTGATGGAGGCTTTTTACCATCCTTTCCTGATGCGGTGATGAATGAAGGACAAACGAAGGTATTTCAAG
TCAGTGTTTATCCTTCTCTTTTTTTGATTAACCCAAAGAGCCAAGTGGCGAGTCTTGTTACTGAAGGCAC
TATTGATGAAGGCGAACTAACCAATCGGTTACTAAAAATTAGCCAGATACATGACAAAGAGGTGCCTTTA
TGA
 Primer design