SecReT4
Protein ID: 52842296
T4SS name [ID]Tra_F [540]
Gene symboltraF
Locus taglpg2082
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2332119..2332901 [-]
Productpilus assembly protein TraF
Component typeTraF_F
UniProt IDQ5ZTS9
KEGG IDlpn:lpg2082
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.4e-64, Aligned region: 29..246
Protein Sequence: 260 a.a.     [Download]
>gi|52842296|ref|YP_096095.1| pilus assembly protein TraF [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MARWFFVLLVSVSPFLYAEQPYLNEHEEGWYWHKDPKEEVKNKPQTESVAPSHVSKPADPDKTWKLIGNR
VQQARAQAILNPTPENIARARRLQRLIVAQANLFSEKWMLDLLINPDQDESLINPSSSAARDIYNQQNSM
QKEKAITQISQTSGLLYFYEGGEPFSERMAQVVSDFANSYHMTVIPIAMTNRISPMLPNSRVDSGQATQM
GVKHIPAVFALNPVSKKTMPVAYGLVSQSELKENILMASNAFQSGDYNAQ
 
Nucleotide Sequence: 783 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2332901-2332119 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
ATGGCTAGATGGTTTTTTGTTTTGTTGGTTAGCGTGAGTCCTTTTTTGTACGCCGAGCAGCCTTATCTTA
ATGAGCATGAGGAAGGTTGGTATTGGCATAAGGATCCCAAAGAGGAAGTCAAGAATAAACCACAAACCGA
GTCAGTGGCACCTTCACATGTAAGTAAACCTGCCGATCCTGATAAAACATGGAAATTGATTGGTAATAGA
GTGCAACAGGCTCGCGCACAAGCTATTTTAAATCCAACTCCTGAAAATATTGCTCGTGCAAGACGATTAC
AACGATTGATTGTGGCACAGGCTAATCTGTTTTCTGAGAAATGGATGCTCGATCTGCTAATAAACCCCGA
TCAGGATGAAAGTCTTATTAATCCGAGCAGTAGTGCAGCACGTGATATCTACAACCAGCAAAACAGCATG
CAAAAGGAAAAGGCGATTACTCAAATTAGTCAAACATCTGGTTTGTTGTATTTCTATGAAGGTGGTGAAC
CATTTAGCGAGCGCATGGCCCAAGTAGTGAGTGATTTTGCGAACAGTTATCACATGACTGTTATTCCAAT
TGCCATGACCAATCGCATCTCCCCGATGTTACCTAACTCACGAGTTGATTCCGGTCAGGCAACTCAGATG
GGTGTTAAACACATTCCTGCGGTTTTTGCTCTTAATCCAGTATCTAAAAAAACCATGCCAGTTGCTTATG
GCTTAGTCAGCCAGTCGGAATTGAAGGAAAACATTTTAATGGCAAGCAACGCTTTTCAATCGGGAGATTA
CAATGCGCAATAA
 Primer design