SecReT4
Protein ID: 52842297
T4SS name [ID]Tra_F [540]
Gene symboltraN
Locus taglpg2083
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2332894..2334705 [-]
Productconjugal transfer protein TraN
Component typeTraN_F
UniProt IDQ5ZTS8
KEGG IDlpn:lpg2083
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1e-80, Aligned region: 303..552
Protein Sequence: 603 a.a.     [Download]
>gi|52842297|ref|YP_096096.1| conjugal transfer protein TraN [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MKGFVLVFLILCSQVFALDLNQAYQEGVQTGTSHTNQSIDLLKALDLSQFPGYQANLPQEHYYSGVTQAS
TGLEADSQTAVAQNDAGKAVGESFNHRPLYQVNPASESMQKLNQIAENGDAIMHGQNTDKTTCSLKPKEC
HYSWQEKTCLSSKVLGVLHCARHLRLDVSPYKTESYSLYLRKGGMRNTPFKVSVNLAQADTCQQGKTPCY
TIYKDLAPAPAILLPANCAMVKVSFLDEKKLVVVEQTATCANPTLSLSVGNCRFGRCTVPYVHSVSMTVE
IYESKEYWDDQCQHLQNKEKEGLCHITEPLTCTEPNQTRIIGDVPLTRPCWKERASYTCGGSQEQNTCDN
LVNQGCEQTASTCVKEEAGLCTTHQQTYQCPINQCTDNQLLCGEDAFCLDGNCAKHELTPANEDDFKKAM
STLSAASDASKDFDGNANFIFKGQLLECSTTMLHFKNCCSDKGWGLDLELAQCSDAEKKLGKARENKLVV
PTGEYCFKRKKLPIGSVCVDHHQTYCVFQSKLARMVQVQGRRDQLHIGFGQNKYSNCSGITPEQLQLIHF
EAIDFSEFYEEVKNKQKQPDYQQTANGISQRLNQFYNQGDING
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2334705-2332894 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
ATGAAAGGCTTCGTTTTAGTTTTTTTAATCCTTTGTTCACAGGTTTTTGCACTTGATTTGAATCAGGCGT
ATCAAGAAGGCGTTCAGACCGGAACAAGCCATACCAATCAATCCATTGATTTATTAAAAGCACTGGATCT
GAGCCAGTTTCCTGGCTATCAAGCCAATCTGCCGCAAGAACATTATTATAGTGGCGTCACGCAGGCAAGC
ACAGGTCTTGAAGCCGATTCGCAAACTGCCGTGGCTCAGAATGATGCAGGAAAGGCAGTAGGCGAAAGTT
TTAATCATCGCCCCTTGTATCAAGTAAATCCTGCCTCGGAATCAATGCAAAAGTTAAATCAAATCGCGGA
AAATGGAGATGCGATTATGCATGGTCAAAATACCGATAAAACCACCTGCTCTTTAAAACCCAAAGAATGC
CATTACTCATGGCAGGAAAAAACATGCCTGTCTAGCAAGGTATTAGGTGTATTGCATTGTGCAAGACACT
TAAGGTTAGATGTTTCCCCCTACAAAACAGAAAGTTACAGTCTATACCTGCGAAAAGGAGGTATGAGGAA
TACCCCTTTTAAAGTCTCAGTTAATCTGGCACAAGCGGATACCTGCCAACAAGGCAAAACTCCTTGCTAT
ACGATTTATAAGGATTTAGCACCAGCACCAGCGATTCTATTGCCTGCCAATTGCGCCATGGTGAAGGTCA
GTTTCCTTGATGAAAAGAAATTAGTGGTTGTTGAGCAAACAGCTACATGCGCCAATCCCACCCTATCATT
GTCTGTTGGCAATTGTCGATTCGGTCGCTGCACAGTGCCCTATGTTCACTCCGTTTCGATGACGGTAGAA
ATTTATGAAAGCAAAGAGTATTGGGACGACCAATGCCAACATTTGCAAAACAAAGAAAAAGAGGGGTTGT
GTCATATTACTGAGCCTCTAACATGCACTGAGCCCAATCAAACACGGATTATTGGCGATGTTCCATTGAC
CCGCCCTTGCTGGAAAGAGAGAGCATCCTACACCTGTGGTGGTAGTCAGGAGCAAAATACGTGCGATAAC
CTAGTTAATCAAGGATGTGAGCAGACTGCTTCAACTTGTGTGAAAGAAGAAGCAGGACTTTGCACAACCC
ATCAGCAAACGTATCAATGCCCGATAAACCAATGTACTGACAACCAACTGTTGTGTGGCGAGGATGCTTT
TTGTTTGGATGGTAATTGCGCGAAACATGAACTAACCCCAGCCAATGAAGACGATTTTAAAAAAGCAATG
TCCACCTTATCCGCCGCCTCGGATGCCTCAAAAGACTTTGATGGCAATGCCAATTTTATTTTCAAAGGTC
AATTGCTTGAATGTTCAACAACAATGCTCCATTTTAAAAATTGTTGCAGTGATAAGGGGTGGGGTCTGGA
TCTTGAGCTGGCACAGTGTAGTGATGCTGAGAAAAAACTGGGAAAAGCTCGAGAAAACAAACTGGTAGTA
CCTACGGGTGAATATTGTTTTAAACGCAAAAAACTCCCTATTGGCTCGGTCTGTGTCGATCATCACCAGA
CTTACTGTGTCTTCCAATCTAAATTAGCCCGTATGGTTCAAGTACAAGGAAGACGTGATCAGTTACATAT
TGGTTTTGGCCAAAATAAATATTCAAATTGCTCGGGTATTACGCCTGAGCAATTGCAATTAATTCACTTC
GAAGCCATTGATTTTTCAGAATTTTATGAGGAGGTAAAAAATAAACAAAAACAACCGGATTACCAACAGA
CTGCCAATGGAATAAGCCAGCGCCTTAATCAATTTTACAATCAAGGAGACATCAATGGCTAG
 Primer design