SecReT4
Protein ID: 52842298
T4SS name [ID]Tra_F [540]
Gene symbol-
Locus taglpg2084
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2334705..2335376 [-]
Productconjugative transfer protein TrbC
Component typeTrbC_F
UniProt IDQ5ZTS7
KEGG IDlpn:lpg2084
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 6.3e-34, Aligned region: 92..201
Protein Sequence: 223 a.a.     [Download]
>gi|52842298|ref|YP_096097.1| conjugative transfer protein TrbC [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MMKTIRMNTSFLVALFLLSFPALAEDEAYIASIEANTKNRANAFTNEIKQISKSLETSEKSGQIAEFTGE
MHQVIKTQEPIVTHLKKVSQVLVFLSFSMPEKSLKAWLLQCKKSGATPVIRGLIHNSFKETMTAIQTLSK
KTGIGMQLDPILFKTFDIAMVPAVVYVKDTPACPANMDCKPVSYDSLYGDVSLDYALEKMRGDEQSEDPV
LDQMILRLRGELI
 
Nucleotide Sequence: 672 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2335376-2334705 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
GTGATGAAAACAATACGAATGAACACTTCTTTCTTGGTTGCATTATTTTTGTTGTCATTTCCTGCACTTG
CAGAAGATGAAGCCTATATTGCGTCTATTGAGGCGAATACAAAAAATCGCGCCAATGCTTTTACAAATGA
AATAAAGCAAATCAGTAAGTCTCTTGAGACTTCAGAAAAATCGGGTCAAATTGCAGAATTTACCGGCGAG
ATGCATCAAGTCATAAAAACACAGGAGCCCATTGTAACCCACTTAAAAAAAGTCAGTCAGGTACTCGTGT
TCTTATCGTTTTCAATGCCAGAAAAAAGTCTAAAAGCCTGGCTTTTACAATGTAAAAAAAGTGGAGCAAC
ACCTGTGATTCGGGGACTAATTCATAATTCGTTTAAAGAAACGATGACGGCTATTCAAACGCTCAGTAAA
AAAACAGGAATTGGGATGCAGCTTGATCCTATTCTTTTTAAAACCTTTGATATCGCTATGGTTCCTGCAG
TGGTTTATGTGAAAGACACCCCTGCTTGTCCTGCCAATATGGATTGCAAACCGGTGAGTTACGACAGTCT
TTATGGTGATGTATCGCTGGACTATGCTTTGGAAAAAATGAGGGGAGATGAGCAGTCAGAAGACCCCGTG
TTGGATCAAATGATTCTTCGGTTAAGAGGGGAATTAATCTAA
 Primer design