SecReT4
Protein ID: 52842299
T4SS name [ID]Tra_F [540]
Gene symboltraU
Locus taglpg2085
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2335389..2336384 [-]
Producthypothetical protein
Component typeTraU_F
UniProt IDQ5ZTS6
KEGG IDlpn:lpg2085
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 3.1e-80, Aligned region: 24..330
Protein Sequence: 331 a.a.     [Download]
>gi|52842299|ref|YP_096098.1| hypothetical protein lpg2085 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MKAFFILIAFLASGLTQAGSCHGRFVNPITDVCWSCLFPFSLGQANLVSSNHLPDTKNPKLPVCECPGNP
IPRLGLTMGYWEPVNLVDVTRTPFCLVNLGGISLNFGKYYRKGAVETDSNLSNQSFYHVHWYKFPLMYWL
NVLTDGICVEKGDFDIAYPSELDVMWNDDELGFVINPEAVLFGSLPAQAACAADSSTALLGSAIDKLFWC
AGAQGSMYPLTGHVQEHVGGVQASVLLSERMNFKLHRQGLLEDTVGLDDSTSSAKSICHTHYSPILPKSR
YRYQMVNPLPTTNACYPLGRATTLWEAGHEYPFKGEDFGYLIWRKRNCCAF
 
Nucleotide Sequence: 996 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2336384-2335389 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
ATGAAAGCCTTTTTTATTCTTATTGCTTTTTTAGCTTCTGGGTTGACCCAAGCAGGATCTTGTCATGGTC
GTTTTGTAAATCCCATTACTGATGTCTGTTGGTCGTGTTTGTTCCCGTTCAGTTTAGGGCAAGCTAATCT
CGTTTCCTCCAATCATTTGCCAGACACTAAAAATCCCAAACTGCCTGTTTGTGAATGCCCAGGAAATCCT
ATACCGAGATTGGGATTAACAATGGGTTATTGGGAGCCTGTTAACTTAGTGGATGTAACCAGAACCCCAT
TTTGCTTAGTTAATTTAGGGGGAATTTCTTTAAATTTTGGCAAGTATTACCGCAAAGGTGCGGTGGAAAC
AGATAGTAATTTATCCAATCAATCATTTTACCACGTGCACTGGTACAAGTTCCCATTGATGTATTGGTTG
AATGTGTTAACTGATGGGATTTGTGTTGAAAAAGGAGACTTTGACATTGCTTATCCGAGTGAATTGGATG
TGATGTGGAATGACGATGAGCTGGGTTTCGTCATTAATCCTGAGGCGGTATTGTTTGGTAGTTTACCCGC
ACAAGCGGCTTGCGCTGCTGATTCAAGTACCGCTTTATTGGGCAGTGCCATTGACAAACTCTTTTGGTGC
GCAGGAGCTCAGGGAAGCATGTACCCTTTAACGGGGCATGTGCAAGAACATGTTGGCGGGGTTCAGGCAT
CAGTCTTACTGTCTGAGCGTATGAATTTTAAACTGCACCGCCAGGGACTATTGGAAGACACAGTAGGACT
TGACGATTCGACAAGCAGCGCAAAATCCATTTGTCATACTCATTATTCCCCTATTTTGCCCAAATCACGT
TACCGCTATCAAATGGTCAATCCTTTACCGACTACTAATGCCTGTTATCCCCTTGGGCGTGCTACGACCC
TATGGGAGGCAGGGCACGAATATCCGTTTAAGGGCGAGGATTTTGGGTATCTGATCTGGCGCAAACGCAA
TTGTTGCGCCTTTTAA
 Primer design