SecReT4
Protein ID: 52842300
T4SS name [ID]Tra_F [540]
Gene symbol-
Locus taglpg2086
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2336381..2336989 [-]
Producthypothetical protein
Component typeTraW_F
UniProt IDQ5ZTS5
KEGG IDlpn:lpg2086
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 202 a.a.     [Download]
>gi|52842300|ref|YP_096099.1| hypothetical protein lpg2086 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MKKLLLIICMLYLPFAEAKDYGVFGKTFEIAEIDFLEYIQQKMKGMQVNGEWKTVQSEFKKRVKEHVARP
TPIRLPRAEDNRTWFFNPSLAVPYDVKDSHGQVIVKQGTVINPLDRVGLSSTLLFFDGDDEAQVAWVTQE
LTQHQKVKLILTSGSVKEVANQLKQAIYFDLNGFLVAKFQIKYLPARVFQAGKRLQINEVTV
 
Nucleotide Sequence: 609 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2336989-2336381 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
GTGAAAAAGCTTCTGTTGATTATTTGCATGCTCTATCTCCCTTTTGCAGAGGCTAAAGACTATGGTGTCT
TTGGCAAAACCTTTGAAATTGCTGAAATAGATTTTTTAGAGTACATCCAGCAAAAAATGAAGGGGATGCA
GGTTAATGGGGAATGGAAGACCGTACAATCTGAGTTTAAAAAACGGGTAAAAGAACATGTGGCACGCCCA
ACACCTATTCGTTTGCCGAGAGCAGAAGACAATAGAACGTGGTTTTTTAATCCATCACTTGCTGTGCCTT
ACGATGTGAAGGACAGTCACGGCCAAGTGATTGTTAAACAAGGCACTGTAATTAACCCCCTGGATAGAGT
GGGCTTGAGTAGCACTCTCCTGTTTTTTGACGGGGATGATGAGGCACAGGTTGCATGGGTTACCCAGGAA
TTAACGCAGCACCAAAAAGTAAAATTAATCCTCACCTCAGGCTCTGTAAAGGAAGTTGCGAATCAATTAA
AGCAAGCTATTTATTTTGATTTAAATGGATTTTTGGTTGCCAAATTTCAAATAAAGTATTTGCCGGCGCG
GGTTTTTCAAGCAGGGAAGCGGTTGCAAATTAATGAGGTGACTGTATGA
 Primer design