SecReT4
Protein ID: 52842301
T4SS name [ID]Tra_F [540]
Gene symboltraC
Locus taglpg2087
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2337314..2339911 [-]
Producthypothetical protein
Component typeTraC_F
UniProt IDQ5ZTS4
KEGG IDlpn:lpg2087
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 2.4e-51, Aligned region: 66..295
AAA_10 [PF12846], Evalue: 3.8e-46, Aligned region: 495..781
Protein Sequence: 865 a.a.     [Download]
>gi|52842301|ref|YP_096100.1| hypothetical protein lpg2087 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MDAAVTIGFKIRGAIMLSTIKKARLAVKKTSTILSHATGSLLETLREELGMTDAHHKKQIEALLDTYCLA
PYLPDEVYDSEADIYPYKQASHMMFECSTLIGASEETVTILTSILTDILPPESCFHALFWASPKIGHMID
EMEHQRNQGSEVLKALAHRRAEFYRKGVYSSLTKESNFVLRDFRLFLCISIPRKSIEDDRLLLGSLREDI
SNNLKSVNIICKELSIEEVISLKREWLFPTDSLYEEKTNYDTNTEIRFQLTDIEASMRVKSNQIEIEREE
DTRVIKCLSVRQYPKSPVQWQLGDLFGKMFNTSLQISCPFLFSFAIRIKDKDKVMAALDAKYADEGQNAK
QPFIAKWVKNFNKKYAEIEELRERLSGDDSLVDSYYNVLLFTTPANVRRDVRRAKDVFRGNQFDLRTPTG
LQLQTLLASMPFAPAEGMFDDYKSFGRVRPLTSFNTVNLLPIQGEWKGAGRFAQVYPQRRGQFTAIYFFD
NVVRNYNVAIVAPPGKGKSFLMNDYIQSLLSQGGFVYIIDVGGSYAKSCEMLNGQLIDFNHDTEISLNLF
STIDAQAKNDTAFKDVHNQLIQLVGMMARPSGNVSDEERSHIEKAIEAMWRQHHNATTITLIAHHLESSN
DPISQNIGRLLYSYTKNGRYGSYFEPPCSLDFKRNLVILELGGLDGNKDLQRIVLKILMYQITNAMYYTP
KHIPKSCLIDESYELLSDNGTGGSANFVNEGYRRAPKYGGNFITVTHGLDDYENNPTAKMCYDNAYYKIF
LGASKSTIDTLKTSNQLDAYGERLIRSLKITNEYSEFLMMCEENSTVHRLIVDPFSRVLNTTRGPEVEAL
KRLMATGLPLADAISKVALEVYGYV
 
Nucleotide Sequence: 2598 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2339911-2337314 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
GTGGATGCAGCAGTCACAATTGGCTTTAAAATAAGGGGAGCCATTATGTTGTCAACTATAAAAAAAGCGC
GTCTTGCAGTTAAAAAAACAAGCACTATTTTAAGTCATGCAACAGGCTCGCTATTGGAAACATTGCGAGA
AGAGCTTGGCATGACTGATGCGCATCATAAAAAGCAAATCGAAGCGCTGTTGGATACTTATTGCTTAGCA
CCTTATTTACCTGACGAGGTTTACGATTCAGAAGCTGATATTTATCCTTACAAACAGGCATCTCATATGA
TGTTTGAATGCTCGACACTGATTGGTGCCAGTGAAGAAACAGTGACTATTCTCACCAGTATATTAACGGA
TATTTTGCCACCGGAAAGTTGTTTTCATGCTTTGTTTTGGGCATCGCCTAAAATTGGCCACATGATTGAT
GAAATGGAACATCAACGCAATCAAGGCAGTGAGGTTTTAAAAGCCCTGGCACACCGACGAGCTGAATTTT
ACCGCAAAGGGGTGTACAGCTCATTAACTAAAGAAAGCAATTTTGTCTTGCGTGATTTTCGTTTATTTTT
ATGTATTTCAATTCCGCGCAAATCCATAGAAGACGATCGCTTGTTGCTTGGTAGTTTGCGCGAAGACATC
AGCAACAATCTAAAGTCAGTCAATATTATTTGTAAAGAACTGTCTATTGAAGAAGTGATTAGCTTAAAGC
GGGAGTGGCTCTTTCCAACCGACAGCTTGTATGAAGAAAAAACCAATTACGATACCAATACTGAAATTCG
TTTTCAACTGACTGACATTGAAGCGAGTATGCGGGTTAAATCCAATCAAATAGAGATTGAGCGAGAAGAA
GATACGAGGGTGATTAAATGCTTGTCCGTTAGGCAATATCCTAAATCCCCTGTGCAATGGCAACTGGGTG
ATTTATTTGGAAAAATGTTTAATACCTCTTTGCAAATAAGTTGTCCCTTTCTTTTTAGTTTTGCAATACG
AATTAAAGATAAAGACAAGGTGATGGCGGCATTAGATGCCAAGTATGCTGATGAAGGGCAAAATGCCAAA
CAACCTTTTATTGCCAAATGGGTCAAAAATTTTAACAAAAAATACGCAGAAATTGAGGAGTTAAGAGAGC
GGCTCAGTGGCGATGATTCTTTGGTTGATTCCTATTATAACGTTTTATTGTTTACAACACCTGCCAATGT
CCGTCGCGATGTACGACGTGCCAAGGATGTATTTCGTGGTAACCAATTTGATTTACGCACGCCAACAGGT
TTGCAGTTACAAACACTTCTAGCCTCCATGCCCTTTGCACCTGCTGAAGGTATGTTTGATGATTACAAAT
CATTTGGACGGGTAAGACCTTTAACCAGTTTTAATACGGTTAACTTATTACCTATCCAGGGGGAATGGAA
AGGGGCAGGACGATTTGCTCAGGTCTATCCACAAAGACGAGGGCAATTTACCGCTATTTATTTTTTTGAC
AACGTAGTCAGAAACTATAATGTCGCTATTGTAGCTCCTCCTGGAAAAGGAAAATCCTTTTTAATGAATG
ACTACATTCAAAGTCTGTTATCCCAGGGGGGCTTTGTTTATATCATTGATGTGGGCGGTTCATACGCTAA
ATCTTGTGAGATGTTGAACGGACAGCTTATTGATTTTAATCATGACACTGAAATTAGCCTAAACCTCTTT
TCTACAATTGATGCACAAGCCAAAAATGATACTGCATTTAAAGACGTTCACAATCAGCTAATACAACTTG
TAGGTATGATGGCAAGACCATCAGGTAACGTCAGTGATGAAGAACGAAGTCATATTGAGAAAGCCATTGA
GGCGATGTGGCGACAACATCACAATGCTACAACTATTACTCTTATTGCTCATCACTTAGAAAGTAGTAAC
GATCCTATTTCTCAAAATATTGGGCGCCTGTTGTATAGCTATACTAAAAACGGTCGTTATGGCAGTTATT
TTGAACCGCCTTGTTCGCTCGATTTTAAAAGAAATTTAGTCATTTTAGAGTTGGGTGGTCTTGATGGAAA
TAAGGATTTGCAGCGCATTGTATTGAAAATCTTAATGTATCAAATCACCAATGCGATGTATTACACGCCA
AAGCACATTCCCAAAAGCTGCTTGATTGATGAATCCTACGAATTACTTTCAGACAATGGTACGGGTGGCA
GTGCTAACTTTGTTAACGAGGGCTATAGGCGTGCGCCTAAATACGGTGGTAATTTTATTACAGTGACTCA
TGGCTTAGATGATTATGAAAACAATCCAACTGCCAAAATGTGTTACGACAACGCCTATTATAAAATCTTT
TTAGGTGCCTCCAAAAGTACGATTGACACTTTAAAAACGAGTAATCAGTTGGATGCTTATGGCGAGCGTT
TAATCCGAAGCCTTAAAATAACTAATGAATACTCTGAGTTTTTAATGATGTGTGAAGAGAATTCAACAGT
GCATCGTTTGATTGTCGATCCATTTTCACGCGTCTTAAACACTACACGTGGTCCTGAAGTCGAGGCCTTG
AAACGATTAATGGCAACAGGTTTGCCATTGGCTGATGCCATTTCCAAAGTTGCCCTGGAGGTGTATGGCT
ATGTTTAA
 Primer design