SecReT4
Protein ID: 52842302
T4SS name [ID]Tra_F [540]
Gene symboltraV
Locus taglpg2088
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2339878..2340228 [-]
Productconjugative transfer: assembly
Component typeTraV_F
UniProt IDQ5ZTS3
KEGG IDlpn:lpg2088
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 7.5e-24, Aligned region: 22..49
TraV [PF09676], Evalue: 7.5e-24, Aligned region: 53..107
Protein Sequence: 116 a.a.     [Download]
>gi|52842302|ref|YP_096101.1| conjugative transfer: assembly [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MKILTTLLLLPCVVLTGCAKLNEDFDCPAPNGGTCKRMDQVYDMVNGKGKSLAVTPSRNPLVMDGRPGQP
VRYGEGVMPLWIAPYEDTDGNYHQANRVYSVVKEGQWMQQSQLALK
 
Nucleotide Sequence: 351 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2340228-2339878 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
ATGAAAATTTTAACTACTTTATTACTGTTGCCCTGTGTTGTTTTGACCGGTTGCGCCAAATTGAATGAGG
ACTTTGATTGCCCAGCTCCCAATGGAGGAACGTGCAAACGTATGGATCAGGTTTATGACATGGTGAATGG
TAAGGGCAAATCCCTGGCTGTAACCCCCAGCCGAAATCCTTTGGTGATGGATGGGCGACCTGGTCAGCCT
GTGCGTTATGGAGAAGGGGTGATGCCTCTTTGGATAGCACCTTATGAAGACACTGATGGCAATTATCATC
AAGCCAATCGAGTGTACAGCGTTGTTAAGGAAGGACAGTGGATGCAGCAGTCACAATTGGCTTTAAAATA
A
 Primer design