SecReT4
Protein ID: 52842303
T4SS name [ID]Tra_F [540]
Gene symbol-
Locus taglpg2089
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2340242..2341561 [-]
Productconjugative transfer protein TraB
Component typeTraB_F
UniProt IDQ5ZTS2
KEGG IDlpn:lpg2089
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6.9e-24, Aligned region: 195..393
Protein Sequence: 439 a.a.     [Download]
>gi|52842303|ref|YP_096102.1| conjugative transfer protein TraB [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MKLLDCTGLANMSIQLKKQQQIFLGIVIGVIVLVIACFALLGNKTVKSREVDKPAYKKHSLASPISTATN
ESHWIEKTQNAWRAELAKSELFDKNLKALGDEKDKQSKLITSQKDELSEMKSTLSELKHQIVKLQMERTT
PIDGTLKNNEPQNGLLPRADEAAASNSMEMDSGFIQYTAKLNKKSKPRIKTPNNYVFSNTFAKAVVLQGA
DASAGVLSQANPDIMIFQIVDDGVMPNKYRAPLKGCMVSASVIGDISSERGKFRTERLSCIHSNGTNIDI
QVTGIISDSKNGIRGRAVWRDEPMVKKAFWGNFWESMGNIGQQYSTDYSTSPLGSVSTIQAGKIPLAAVS
SGGSGAAKMYAQYNIKRAEMYHPIIQLPPIVTVDVTFLKGFWLDGGTDTNAPEQPEESQNSKVAFEAPAE
SETAEEKAANQFFYKNHSF
 
Nucleotide Sequence: 1320 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2341561-2340242 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
TTGAAACTACTCGATTGTACAGGATTAGCTAACATGTCTATTCAACTTAAAAAACAACAACAGATCTTTT
TAGGGATTGTTATCGGCGTTATAGTGTTGGTGATTGCGTGCTTTGCCTTATTGGGAAACAAGACAGTTAA
ATCCAGAGAGGTTGATAAACCCGCTTATAAAAAACACAGCTTAGCCAGCCCGATATCTACTGCCACTAAT
GAATCCCATTGGATTGAGAAAACACAAAATGCCTGGCGAGCTGAGCTTGCAAAATCAGAGCTCTTTGATA
AAAACCTCAAGGCATTAGGTGATGAAAAAGACAAGCAAAGCAAGCTCATTACCTCGCAAAAAGATGAACT
ATCTGAAATGAAATCCACACTTTCTGAATTAAAGCATCAAATAGTTAAGCTACAAATGGAGCGTACTACC
CCAATAGATGGGACATTAAAAAACAATGAGCCTCAAAATGGGTTGTTACCCCGAGCAGATGAAGCGGCAG
CGAGCAACTCCATGGAGATGGATTCGGGATTTATTCAATACACAGCCAAGTTAAATAAAAAATCCAAGCC
ACGAATCAAAACACCCAATAATTATGTCTTCTCCAACACCTTTGCTAAAGCAGTTGTTTTACAAGGTGCA
GATGCATCTGCGGGAGTTTTAAGCCAAGCAAATCCCGACATTATGATATTTCAAATTGTCGATGATGGAG
TGATGCCGAATAAATACAGGGCACCACTTAAAGGCTGTATGGTAAGTGCTTCTGTAATTGGCGATATTTC
CAGTGAGCGAGGAAAGTTTCGTACCGAACGATTAAGTTGCATTCATTCCAATGGCACCAATATCGACATC
CAGGTTACAGGCATCATTTCAGATTCTAAAAACGGAATTCGTGGGCGTGCGGTATGGCGTGATGAACCGA
TGGTGAAAAAAGCTTTTTGGGGGAACTTCTGGGAAAGCATGGGCAATATTGGCCAGCAATATTCCACTGA
TTACAGCACCTCGCCTCTAGGAAGTGTATCAACCATTCAAGCAGGAAAAATTCCTCTCGCGGCTGTTTCT
AGTGGCGGATCGGGCGCTGCAAAAATGTATGCGCAATACAACATCAAGCGTGCTGAAATGTACCACCCGA
TTATTCAATTGCCTCCAATCGTTACAGTAGATGTAACTTTTCTTAAGGGTTTTTGGCTTGATGGGGGAAC
GGACACTAATGCCCCTGAACAACCAGAAGAAAGCCAAAATTCCAAAGTAGCTTTTGAAGCCCCTGCCGAG
TCTGAGACTGCTGAAGAAAAAGCTGCCAACCAATTTTTCTATAAAAACCACTCTTTCTAA
 Primer design