SecReT4
Protein ID: 52842304
T4SS name [ID]Tra_F [540]
Gene symbol-
Locus taglpg2090
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2341530..2342243 [-]
Productconjugative transfer protein TraK
Component typeTraK_F
UniProt IDQ5ZTS1
KEGG IDlpn:lpg2090
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 3.9e-59, Aligned region: 1..234
Protein Sequence: 237 a.a.     [Download]
>gi|52842304|ref|YP_096103.1| conjugative transfer protein TraK [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MKQMAMIFSLGLLIATAEGAQIKTVRNYEDIFINASIKEPNNLMLEDDRIQQIKAPGNTLVDACNGKANC
KLIDDTTGILTFLPSPLYHTRAFTINLLTEKGLFYNVRVEPKPIASQTIVFKSYRNPVIRARAPHTSSYE
KVMVGFLRALVNGYLPEGFTQTIPKNPSVYKAQKTQLKRLLTVNGNRMRGEIFELKNVTNQPIDAKESWF
NWPGTKGVALAKTHLAPFETTRLYRIS
 
Nucleotide Sequence: 714 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2342243-2341530 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
ATGAAACAAATGGCAATGATATTCAGCTTAGGCTTATTAATAGCAACAGCAGAAGGTGCTCAAATAAAAA
CAGTCAGAAATTATGAAGATATTTTCATTAATGCCTCAATTAAAGAACCCAATAATCTTATGTTAGAGGA
TGATCGCATTCAGCAAATAAAAGCACCTGGCAACACCCTGGTTGATGCATGCAATGGGAAGGCGAATTGC
AAATTAATTGATGATACGACGGGTATTCTTACTTTTTTGCCATCGCCTCTATACCACACACGAGCTTTTA
CTATCAATTTGCTGACTGAAAAAGGTCTTTTTTACAACGTGCGTGTAGAACCAAAGCCCATTGCGTCACA
AACAATCGTTTTTAAATCCTACAGAAATCCTGTAATTCGTGCCCGCGCTCCACATACATCAAGTTATGAA
AAGGTGATGGTTGGTTTTTTACGAGCGCTTGTTAATGGGTATTTGCCAGAAGGTTTTACCCAAACAATAC
CCAAAAATCCTTCAGTCTATAAAGCACAAAAAACACAACTAAAACGCTTATTGACAGTTAATGGCAATCG
TATGCGGGGTGAAATTTTTGAGTTAAAAAACGTAACCAACCAGCCTATTGATGCCAAGGAATCCTGGTTT
AATTGGCCTGGAACCAAAGGGGTGGCGCTTGCTAAAACCCATTTAGCGCCGTTTGAAACTACTCGATTGT
ACAGGATTAGCTAA
 Primer design