SecReT4
Protein ID: 52842305
T4SS name [ID]Tra_F [540]
Gene symbol-
Locus taglpg2091
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2342246..2342809 [-]
Productconjugative transfer protein TraE
Component typeTraE_F
UniProt IDQ5ZTS0
KEGG IDlpn:lpg2091
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 3.9e-35, Aligned region: 3..187
Protein Sequence: 187 a.a.     [Download]
>gi|52842305|ref|YP_096104.1| conjugative transfer protein TraE [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MKIEQKKSELMKEKKIRVLFIGISSVLLAMTFMQSITIVVLLHYAHSKHETHFIPPKISQEFTLSGTGVS
EGYLRDMTNFLTQLRFNITSSSATYQFNALLGYVAPSLYGDIRAQLVKEVEQINHEHLSSVFYPSTFEID
IKHLSVKVMGQMKRFVGADLMSDVRETFLIRYSYEYGLLKLTNLEKV
 
Nucleotide Sequence: 564 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2342809-2342246 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
ATGAAAATAGAACAAAAAAAATCAGAATTAATGAAGGAAAAAAAGATTAGGGTTTTATTCATAGGTATTA
GTAGTGTGCTGCTAGCTATGACATTCATGCAATCAATTACCATTGTGGTCTTATTGCATTATGCTCATAG
CAAACATGAAACCCATTTCATCCCACCTAAAATATCTCAAGAATTTACACTTTCTGGAACAGGTGTTTCG
GAAGGTTATTTAAGAGACATGACCAATTTCTTAACGCAACTTCGTTTTAATATCACTTCAAGTTCAGCCA
CTTACCAATTTAATGCGCTCTTAGGCTATGTAGCTCCCTCACTGTATGGGGACATCAGGGCGCAATTGGT
TAAGGAAGTCGAACAAATTAATCACGAACATTTATCCAGCGTGTTTTATCCATCGACCTTTGAAATTGAT
ATCAAACACTTGAGCGTAAAAGTAATGGGACAGATGAAGCGTTTTGTTGGCGCGGATTTGATGTCTGATG
TACGGGAGACTTTTTTGATTAGGTATTCCTATGAGTATGGCCTGTTGAAACTAACGAATCTTGAGAAGGT
GTAA
 Primer design