SecReT4
Protein ID: 52842306
T4SS name [ID]Tra_F [540]
Gene symbol-
Locus taglpg2092
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2342813..2343106 [-]
Productsex pilus assembly protein-like
Component typeTraL_F
UniProt IDQ5ZTR9
KEGG IDlpn:lpg2092
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1e-27, Aligned region: 5..97
Protein Sequence: 97 a.a.     [Download]
>gi|52842306|ref|YP_096105.1| sex pilus assembly protein-like [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MEDPRKYKTPQYLNEPYRLIIFTLDEVMVGALTLYVFGAVCGFFVTSLILTCAFLFLMKRMKGNEGPYFY
IHLFYWFFSLSPKLRATPPSWIRAFLG
 
Nucleotide Sequence: 294 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2343106-2342813 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
ATGGAAGATCCGAGAAAATACAAAACACCCCAATATCTTAATGAGCCTTATCGATTGATTATTTTTACAC
TCGATGAGGTCATGGTAGGAGCACTAACTCTCTACGTATTTGGGGCTGTTTGTGGTTTTTTTGTTACCTC
ATTGATTCTAACCTGTGCGTTTCTATTTCTTATGAAACGCATGAAGGGTAATGAAGGTCCCTATTTTTAT
ATCCACCTTTTTTATTGGTTCTTTTCTCTATCACCTAAGTTACGGGCAACACCACCGTCATGGATTAGAG
CGTTTTTGGGGTAA
 Primer design