SecReT4
Protein ID: 52842307
T4SS name [ID]Tra_F [540]
Gene symbol-
Locus taglpg2093
StrainLegionella pneumophila subsp. pneumophila str. Philadelphia 1
Repliconchromosome [GenBank: NC_002942] [Browse all T4SS(s) in this replicon]
Location [Strand]2343108..2343410 [-]
Productfimbrial protein -like
Component typeTraA_F
UniProt IDQ5ZTR8
KEGG IDlpn:lpg2093
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 100 a.a.     [Download]
>gi|52842307|ref|YP_096106.1| fimbrial protein -like [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MSLLNQFRSNVLSSINAHIGKIFILICLLIMAQGTFAADALSAAEEVVKDTYNGSIKTYLYVGEAVAAVV
TLMFTRNIKTLGGVGAMAIFLNVVAMLAGV
 
Nucleotide Sequence: 303 bp     [Download]
>gi|52840256|ref|NC_002942.5|:c2343410-2343108 Legionella pneumophila subsp. pneumophila str. Philadelphia 1 chromosome, complete genome
ATGTCTTTATTAAATCAGTTCAGAAGTAACGTGTTAAGCAGTATTAATGCTCACATTGGAAAGATTTTCA
TACTTATTTGCTTGCTAATAATGGCTCAAGGAACCTTTGCAGCGGATGCTTTATCCGCTGCAGAAGAAGT
AGTTAAGGATACCTACAATGGTTCGATAAAAACCTATCTTTATGTCGGAGAAGCTGTAGCGGCTGTTGTT
ACCTTGATGTTTACTCGAAATATTAAAACGCTTGGCGGCGTTGGGGCGATGGCTATTTTTCTAAATGTCG
TTGCAATGCTAGCAGGGGTTTAA
 Primer design