SecReT4
Protein ID: 53793916
T4SS name [ID]Trb [48]
Gene symboltrbB
Locus tagpTB11p15
Strainuncultured bacterium plasmid pTB11 (NC_006352)
Repliconplasmid pTB11 [GenBank: NC_006352] [Browse all T4SS(s) in this replicon]
Location [Strand]15087..16046 [+]
Productconjugal transfer ATPase TrbB
Component typeTrbB
UniProt IDQ5ZHI1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.5e-88, Aligned region: 26..294
FtsK_SpoIIIE [PF01580], Evalue: 1.5e-07, Aligned region: 124..183
AAA_19 [PF13245], Evalue: 4.2e-07, Aligned region: 140..188
AAA_10 [PF12846], Evalue: 7.6e-07, Aligned region: 149..189
DUF87 [PF01935], Evalue: 2.6e-06, Aligned region: 148..189
AAA_29 [PF13555], Evalue: 3.5e-05, Aligned region: 148..173
Protein Sequence: 319 a.a.     [Download]
>gi|53793916|ref|YP_112369.1| conjugal transfer ATPase TrbB [uncultured bacterium]
MSGKEEFQTIKERAKRKLERDMGADLLAALNDPKTVEVMLNADGKVWHERLGEPMRYICDMRPSQSQAII
ETVAGFHGKEVTRHSPILEGEFPLDGSRFAGQLPPVVAAPTFAIRKRAVAIFTLEQYVEAGIMTREQYEV
IKSAVAAHRNILVIGGTGSGKTTLVNAIINEMVAFNPSERVVIIEDTGEIQCAAENAVQYHTSIDVSMTL
LLKTTLRMRPDRILVGEVRGPEALDLLMAWNTGHEGGAATLHANNPKAGLSRLAMLISMHPDSPKPIEPL
IGEAVHVVVHIARTPSGRRVQEILEVLGYENGQYITKTL
 
Nucleotide Sequence: 960 bp     [Download]
>gi|53793901|ref|NC_006352.1|:15087-16046 Uncultured bacterium activated sludge plasmid pTB11, complete sequence
GTGAGCGGGAAAGAAGAGTTTCAGACCATCAAGGAGCGGGCCAAGCGCAAGCTGGAACGCGACATGGGTG
CGGACCTGTTGGCCGCGCTCAACGACCCGAAAACCGTTGAAGTCATGCTCAACGCGGACGGCAAGGTGTG
GCACGAACGCCTTGGCGAGCCGATGCGGTACATCTGCGACATGCGGCCCAGCCAGTCGCAGGCGATTATA
GAAACGGTGGCCGGATTCCACGGCAAAGAGGTCACGCGGCATTCGCCCATCCTGGAAGGCGAGTTCCCCT
TGGATGGCAGCCGCTTTGCCGGCCAATTGCCGCCGGTCGTGGCCGCGCCAACCTTTGCGATCCGCAAGCG
CGCGGTCGCCATCTTCACGCTGGAACAGTACGTCGAGGCGGGCATCATGACCCGCGAGCAATACGAGGTC
ATTAAAAGCGCCGTCGCGGCGCATCGAAACATCCTCGTCATTGGCGGTACTGGCTCGGGCAAGACCACGC
TCGTCAACGCGATCATCAATGAAATGGTCGCCTTCAACCCGTCTGAGCGCGTCGTCATCATCGAGGACAC
CGGCGAAATCCAGTGCGCCGCAGAGAACGCCGTCCAATACCACACCAGCATCGACGTCTCGATGACGCTG
CTGCTCAAGACAACGCTGCGTATGCGCCCCGACCGCATCCTGGTCGGTGAGGTACGTGGCCCCGAAGCCC
TTGATCTGTTGATGGCCTGGAACACCGGGCATGAAGGAGGTGCCGCCACCCTGCACGCAAACAACCCCAA
AGCGGGCCTGAGCCGGCTCGCCATGCTTATCAGCATGCACCCGGATTCACCGAAACCCATTGAGCCGCTG
ATTGGCGAGGCGGTTCATGTGGTCGTCCATATCGCCAGGACCCCTAGCGGCCGTCGAGTGCAAGAAATTC
TCGAAGTTCTTGGTTACGAGAACGGCCAGTACATCACCAAAACCCTGTAA
 Primer design