SecReT4
Protein ID: 53793917
T4SS name [ID]Trb [48]
Gene symboltrbC
Locus tagpTB11p16
Strainuncultured bacterium plasmid pTB11 (NC_006352)
Repliconplasmid pTB11 [GenBank: NC_006352] [Browse all T4SS(s) in this replicon]
Location [Strand]16059..16496 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ5ZHI0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.5e-19, Aligned region: 16..110
Protein Sequence: 145 a.a.     [Download]
>gi|53793917|ref|YP_112370.1| conjugal transfer protein TrbC [uncultured bacterium]
MTTAVPFRLTMNRGILFYLAVFFVLALALSAHPAMASEGTGGSLPYESWLTNLRNSVTGPVAFALSIIGI
VVAGGVLIFGGELNAFFRTLIFLVLVMALLVGAQNVMSTFFGRGAEIAALGNGALHQVQVAAADAVRAVA
AGRLA
 
Nucleotide Sequence: 438 bp     [Download]
>gi|53793901|ref|NC_006352.1|:16059-16496 Uncultured bacterium activated sludge plasmid pTB11, complete sequence
ATGACAACGGCTGTTCCGTTCCGTCTGACCATGAATCGCGGCATTTTGTTCTACCTTGCCGTGTTCTTCG
TTCTCGCTCTCGCGTTATCCGCGCATCCGGCGATGGCCTCGGAAGGCACCGGCGGCAGCTTGCCATATGA
GAGCTGGCTGACGAACCTGCGCAACTCCGTAACCGGCCCGGTGGCCTTCGCGCTGTCCATCATCGGCATC
GTCGTCGCCGGCGGCGTGCTGATCTTCGGCGGCGAACTCAACGCCTTCTTCCGAACCCTGATCTTCCTGG
TTCTGGTGATGGCGCTGCTGGTCGGCGCGCAGAACGTGATGAGCACCTTCTTCGGTCGTGGTGCCGAAAT
CGCGGCCCTCGGCAACGGGGCGCTGCACCAGGTGCAAGTCGCGGCGGCGGATGCCGTGCGTGCGGTAGCG
GCTGGACGGCTCGCCTAA
 Primer design