SecReT4
Protein ID: 53793918
T4SS name [ID]Trb [48]
Gene symboltrbD
Locus tagpTB11p17
Strainuncultured bacterium plasmid pTB11 (NC_006352)
Repliconplasmid pTB11 [GenBank: NC_006352] [Browse all T4SS(s) in this replicon]
Location [Strand]16499..16810 [+]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDQ5ZHH9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 5.2e-27, Aligned region: 1..87
Protein Sequence: 103 a.a.     [Download]
>gi|53793918|ref|YP_112371.1| conjugal transfer protein TrbD [uncultured bacterium]
MALRTIPIRRAGNRENLFMGGDRELVMFSGLMAFALIFSAQELRATVVGLILWFGALYAFRIMAKADPKM
RFVYLRHRRYKPYYPARSTPFRENTNSQGKQYR
 
Nucleotide Sequence: 312 bp     [Download]
>gi|53793901|ref|NC_006352.1|:16499-16810 Uncultured bacterium activated sludge plasmid pTB11, complete sequence
ATGGCTCTGCGCACGATCCCCATCCGTCGCGCAGGCAACCGAGAAAACCTGTTCATGGGTGGTGATCGTG
AACTGGTGATGTTCTCGGGCCTGATGGCGTTTGCGCTGATTTTCAGCGCCCAAGAGCTGCGGGCCACCGT
GGTCGGTCTGATCCTGTGGTTCGGGGCGCTCTATGCGTTCCGAATCATGGCGAAGGCCGATCCGAAGATG
CGGTTCGTGTACCTGCGTCACCGCCGGTACAAGCCGTATTACCCGGCCCGCTCGACCCCGTTCCGCGAGA
ACACCAATAGCCAAGGGAAGCAATACCGATGA
 Primer design