SecReT4
Protein ID: 53793919
T4SS name [ID]Trb [48]
Gene symboltrbE
Locus tagpTB11p18
Strainuncultured bacterium plasmid pTB11 (NC_006352)
Repliconplasmid pTB11 [GenBank: NC_006352] [Browse all T4SS(s) in this replicon]
Location [Strand]16807..19365 [+]
Productconjugal transfer protein TrbE
Component typeTrbE
UniProt IDQ5ZHH8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 3.7e-50, Aligned region: 223..431
AAA_10 [PF12846], Evalue: 6.8e-30, Aligned region: 489..771
Protein Sequence: 852 a.a.     [Download]
>gi|53793919|ref|YP_112372.1| conjugal transfer protein TrbE [uncultured bacterium]
MIQAIAIAIAGLGALLLFILFARIRAVDAELKLKKHRSKDAGLADLLNYAAVVDDGVIVGKNGSFMAAWL
YKGDDNASSTDQQREVVSARINQALAGLGSGWMIHVDAVRRPAPNYAERGLSAFPDRLTAAIEEERRRHF
ESLGTMYEGYFVLTLTWFPPLLAQRKFVELMFDDDATAPDRKARTRGLIDQFKRDVRSIESRLSSAVSLT
RLKGHKIVNEDGTTVTHDDFLRWLQFCVTGLHHPVQLPSNPMYLDALVGGQEMWGGVVPKVGRKFVQVVA
LEGFPLESYPGILTALGELPCEYRWSSRFIFMDQHEAVKHLDKFRKKWRQKIRGFFDQVFNTNTGPVDQD
ALSMVADAEAAIAEVNSGIVAVGYYTSVVVLMDEDRTRLEAAARDVEKAVNRLGFAARIESINTLDAFLG
SLPGHGVENVRRPLINTMNLADLLPTSTIWTGNANAPCPMYPPLSPALMHCVTQGSTPFRLNLHVRDLGH
TFMFGPTGAGKSTHLAILAAQLRRYAGMSIFAFDKGMSMYPLAAGIRAATKGTSGLHFTVAADDERLAFC
PLQFLSTKGDRAWAMEWIDTILALNGVETTPAQRNEIGNAIMSMHASGARTLSEFSVTIQDEAIREAIRQ
YTVDGAMGHLLDAEEDGLALSDFTVFEIEELMNLGEKFALPVLLYLFRRIERALTGQPAVIILDEAWLML
GHPAFRAKIREWLKVLRKANCLVLMATQSLSDAANSGILDVIVESTATKIFLPNIYARDEDTAALYRRMG
LNARQIEILAQAVPKRQYYYVSENGRRLYDLALGPLALAFVGASDKESVAIIKNLEAKFGDQWVDEWLRG
RGLALDEYLEAA
 
Nucleotide Sequence: 2559 bp     [Download]
>gi|53793901|ref|NC_006352.1|:16807-19365 Uncultured bacterium activated sludge plasmid pTB11, complete sequence
ATGATCCAAGCAATTGCGATTGCAATCGCGGGCCTCGGCGCGCTTCTGTTGTTCATCCTCTTTGCCCGCA
TCCGCGCGGTCGATGCCGAACTGAAACTGAAAAAGCATCGTTCCAAGGACGCCGGCCTGGCCGATCTGCT
CAACTACGCCGCTGTCGTCGATGACGGCGTAATCGTGGGCAAGAACGGCAGCTTTATGGCTGCCTGGCTG
TACAAGGGCGATGACAACGCAAGCAGCACCGACCAGCAGCGCGAAGTAGTGTCCGCCCGCATCAACCAGG
CCCTCGCGGGCCTGGGAAGTGGGTGGATGATCCATGTGGACGCCGTGCGGCGTCCTGCTCCGAACTACGC
GGAGCGGGGCCTGTCGGCGTTCCCTGACCGTCTGACGGCAGCGATTGAAGAAGAGCGCCGGCGGCATTTC
GAGAGCCTGGGAACGATGTACGAGGGCTATTTCGTCCTCACCTTGACCTGGTTCCCGCCGCTGCTCGCCC
AGCGCAAGTTCGTCGAGCTGATGTTTGACGACGACGCGACCGCACCGGATCGCAAGGCGCGCACGCGGGG
CCTCATCGACCAATTCAAGCGTGACGTGCGCAGCATCGAGTCGCGCCTGTCGTCGGCCGTGTCGCTCACT
CGCTTGAAGGGGCACAAGATCGTCAACGAGGACGGCACGACCGTCACGCATGACGACTTCCTGCGCTGGC
TGCAATTCTGCGTGACGGGCCTGCACCATCCGGTGCAGCTCCCCAGCAACCCGATGTACCTGGACGCCCT
GGTCGGCGGACAGGAAATGTGGGGCGGGGTAGTGCCCAAGGTCGGCCGCAAGTTCGTCCAGGTGGTCGCT
CTCGAAGGCTTCCCCTTGGAGTCCTATCCCGGCATCCTGACGGCGCTCGGCGAGCTGCCCTGCGAGTATC
GGTGGTCGAGCCGGTTCATCTTCATGGACCAGCACGAAGCCGTGAAGCACCTCGACAAGTTCCGCAAGAA
GTGGCGGCAGAAGATTCGCGGCTTCTTCGACCAGGTGTTCAACACGAACACCGGCCCGGTCGATCAGGAC
GCGCTTTCGATGGTGGCCGATGCTGAGGCGGCCATTGCCGAAGTCAACAGCGGCATCGTGGCCGTGGGCT
ACTACACCAGCGTCGTCGTGCTGATGGATGAGGACCGCACGCGCCTGGAAGCTGCGGCCCGCGATGTTGA
AAAGGCCGTCAACCGGTTGGGCTTTGCCGCGCGCATCGAGTCCATCAACACCCTGGACGCCTTCCTTGGT
AGTTTGCCGGGCCACGGCGTGGAAAACGTCCGCCGGCCGCTCATCAACACGATGAACCTGGCCGACCTGC
TGCCGACCAGCACCATCTGGACCGGCAACGCGAACGCGCCATGCCCGATGTACCCGCCGCTGTCGCCGGC
GCTCATGCACTGCGTCACGCAAGGATCAACGCCGTTCCGGCTGAACCTGCACGTGCGCGACCTCGGCCAC
ACCTTTATGTTCGGGCCGACCGGCGCAGGTAAATCGACGCACCTGGCGATCCTCGCCGCGCAGCTCCGTC
GCTATGCCGGCATGTCGATCTTCGCCTTTGACAAGGGCATGTCGATGTACCCGCTGGCCGCCGGCATCCG
TGCGGCCACGAAGGGCACCAGCGGCCTGCACTTCACCGTGGCGGCCGACGACGAACGCCTGGCGTTCTGC
CCGTTGCAGTTCCTGAGCACCAAGGGCGACCGTGCTTGGGCGATGGAGTGGATCGACACCATCCTGGCGT
TGAACGGCGTCGAAACGACCCCGGCCCAGCGCAACGAAATCGGCAACGCGATCATGAGCATGCACGCCAG
CGGCGCGCGCACGCTCTCCGAGTTCAGCGTGACGATTCAGGATGAGGCGATCCGCGAGGCGATCCGCCAG
TACACCGTCGATGGCGCAATGGGCCATCTGCTCGACGCCGAAGAGGACGGCTTGGCGCTGTCCGACTTTA
CAGTGTTCGAGATCGAAGAGCTGATGAACCTCGGCGAGAAATTCGCCCTGCCTGTGTTGCTCTACCTGTT
CCGCCGTATCGAGCGCGCCCTGACGGGCCAGCCGGCCGTCATCATCCTGGACGAAGCCTGGTTGATGCTC
GGCCACCCGGCATTCCGCGCGAAGATCAGGGAATGGCTCAAGGTGCTGCGTAAGGCCAACTGCCTTGTGC
TGATGGCAACGCAGAGCCTGTCCGACGCCGCCAACAGCGGCATCCTGGACGTGATCGTGGAATCGACCGC
GACCAAGATTTTCCTGCCGAATATTTACGCCAGGGATGAGGACACGGCGGCCCTGTACCGCCGCATGGGC
CTGAACGCTCGCCAGATCGAGATTCTGGCCCAGGCCGTTCCCAAGCGTCAGTACTACTACGTGTCGGAAA
ACGGCCGCCGTCTCTACGACCTGGCACTTGGCCCGCTCGCGCTCGCGTTCGTCGGCGCATCCGACAAGGA
ATCCGTCGCCATCATCAAGAACCTGGAAGCCAAGTTCGGCGACCAGTGGGTGGATGAATGGCTGCGTGGC
CGGGGCCTCGCCCTTGATGAATACCTGGAGGCAGCATGA
 Primer design