SecReT4
Protein ID: 53793920
T4SS name [ID]Trb [48]
Gene symboltrbF
Locus tagpTB11p19
Strainuncultured bacterium plasmid pTB11 (NC_006352)
Repliconplasmid pTB11 [GenBank: NC_006352] [Browse all T4SS(s) in this replicon]
Location [Strand]19362..20120 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ5ZHH7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.1e-56, Aligned region: 39..250
Protein Sequence: 252 a.a.     [Download]
>gi|53793920|ref|YP_112373.1| conjugal transfer protein TrbF [uncultured bacterium]
MSFADTIKGLIFKKKPATAAAAATPAATGPQTDNPYLTARRTWNDHVGSVVSQKQTWQVVGILSLMIVLA
AVGGIIHIGSQSKFVPYVYEVDKLGQTAAVGPMTRASKADPRVIHASVAEFVGDARLVTPDVALQRKAVY
RLYAKLGPNDPATAKMNEWLNGTADASPFARAAVETVSTEITSVIPQTPDTWQVDWVETTRDRQGVVKGQ
PVRMRALVTVYVVEPTADTKEEQLRNNPAGIYVRDFSWSRLL
 
Nucleotide Sequence: 759 bp     [Download]
>gi|53793901|ref|NC_006352.1|:19362-20120 Uncultured bacterium activated sludge plasmid pTB11, complete sequence
ATGAGTTTTGCAGACACGATCAAGGGCTTGATCTTCAAGAAGAAGCCCGCAACGGCCGCAGCAGCGGCGA
CGCCGGCCGCGACCGGCCCGCAAACCGACAACCCGTACCTGACGGCGCGGCGCACCTGGAACGACCACGT
TGGTTCCGTTGTGTCGCAAAAGCAGACCTGGCAGGTTGTCGGCATCCTTTCGCTGATGATCGTCCTCGCG
GCGGTCGGCGGCATCATCCACATCGGCAGCCAGTCGAAGTTCGTGCCCTATGTCTACGAGGTAGACAAGC
TCGGGCAGACGGCCGCCGTGGGGCCGATGACCAGGGCGTCGAAAGCCGATCCGCGTGTCATTCACGCCTC
GGTGGCTGAGTTCGTCGGCGATGCTCGCCTGGTGACGCCGGACGTAGCTTTGCAGCGCAAGGCCGTCTAC
CGCCTCTATGCCAAGCTCGGGCCGAATGACCCGGCCACCGCCAAGATGAACGAATGGCTCAACGGCACCG
CCGACGCCAGCCCGTTCGCTCGCGCGGCCGTCGAAACGGTCAGCACCGAAATCACTTCCGTAATCCCGCA
GACGCCCGACACCTGGCAGGTCGATTGGGTCGAGACGACGCGCGACAGGCAAGGCGTGGTGAAAGGCCAG
CCCGTGCGCATGCGGGCCTTGGTGACGGTCTACGTCGTCGAGCCGACGGCGGACACCAAGGAAGAACAAC
TGCGAAACAACCCGGCCGGGATCTACGTCCGGGACTTCTCCTGGTCGAGACTTCTGTGA
 Primer design