SecReT4
Protein ID: 53793921
T4SS name [ID]Trb [48]
Gene symboltrbG
Locus tagpTB11p20
Strainuncultured bacterium plasmid pTB11 (NC_006352)
Repliconplasmid pTB11 [GenBank: NC_006352] [Browse all T4SS(s) in this replicon]
Location [Strand]20132..21025 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ5ZHH6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.1e-64, Aligned region: 72..295
Protein Sequence: 297 a.a.     [Download]
>gi|53793921|ref|YP_112374.1| conjugal transfer protein TrbG [uncultured bacterium]
MKKELFALVLAASVSVPAFAADPGADLTDLYFSGKNPELTAQERAAIAIAKKWEAGTAGMRPVAGPGGSV
RFLFGAQQPSIVCAVLQVCDVALQPGEQVNSINLGDTARWTVEPAITGSGANETQHLIIKPMDVGLETSL
VVTTDRRSYHMRLRSHRTQYMQQVSFTYPEDALAKWDAIKNREQRDRVEKTIPQTGEYLGNLSFNYSVSG
STSWKPVRVYNDGKKTIIQMPHSMEQTEAPTLLVVRREGGLFSDDETVMVNYRVQGDRYIVDTIFDKAIL
IAGVGSSQDRVTISRGN
 
Nucleotide Sequence: 894 bp     [Download]
>gi|53793901|ref|NC_006352.1|:20132-21025 Uncultured bacterium activated sludge plasmid pTB11, complete sequence
ATGAAAAAGGAACTGTTTGCTTTGGTCCTGGCCGCGTCCGTTAGCGTGCCTGCATTTGCCGCCGATCCCG
GCGCGGACCTGACTGACCTCTATTTTTCCGGCAAGAACCCGGAGCTGACCGCGCAAGAGCGGGCGGCCAT
CGCCATCGCCAAGAAGTGGGAGGCGGGTACCGCCGGCATGCGGCCGGTGGCCGGCCCCGGTGGTTCGGTG
CGCTTCCTGTTCGGCGCGCAGCAGCCGAGCATCGTATGCGCCGTGCTGCAAGTGTGCGACGTGGCCCTGC
AACCCGGCGAGCAAGTCAACTCGATCAACCTGGGCGACACCGCCCGTTGGACGGTCGAGCCGGCCATTAC
CGGCAGCGGCGCGAACGAAACCCAGCACCTCATCATCAAGCCGATGGATGTGGGCCTGGAAACCAGCCTG
GTCGTGACCACGGACCGCCGCAGCTACCACATGCGCCTGCGCTCGCATCGCACGCAGTACATGCAGCAGG
TGTCGTTCACCTACCCGGAAGATGCCCTTGCGAAGTGGGACGCCATCAAGAACCGCGAACAGCGGGATCG
CGTCGAGAAAACCATTCCGCAGACCGGCGAGTACCTGGGCAACCTGAGCTTCAACTACTCCGTCAGCGGG
TCCACGTCGTGGAAGCCGGTGCGCGTCTACAACGACGGCAAGAAAACCATCATCCAGATGCCGCACTCGA
TGGAACAGACCGAAGCGCCGACGCTCCTGGTCGTTCGCAGGGAGGGCGGCCTGTTCTCCGACGATGAAAC
GGTGATGGTCAACTACCGGGTCCAGGGCGACCGCTACATCGTCGATACGATTTTCGACAAGGCCATCCTC
ATCGCGGGCGTGGGCAGCAGCCAGGACCGCGTGACCATTTCAAGGGGGAACTAA
 Primer design