SecReT4
Protein ID: 53793922
T4SS name [ID]Trb [48]
Gene symboltrbH
Locus tagpTB11p21
Strainuncultured bacterium plasmid pTB11 (NC_006352)
Repliconplasmid pTB11 [GenBank: NC_006352] [Browse all T4SS(s) in this replicon]
Location [Strand]21029..21511 [+]
Productconjugal transfer protein TrbH
Component typeTrbH
UniProt IDQ5ZHH5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 7.9e-51, Aligned region: 31..160
Protein Sequence: 160 a.a.     [Download]
>gi|53793922|ref|YP_112375.1| conjugal transfer protein TrbH [uncultured bacterium]
MRKILTVIALAATLAGCATSKYGSFVQDAPAAYNQTIATDAVKQLVKLYPPAQTKLELQQATPDPFGIAL
VTDLRAQGYAVMEYKPDGNAAAAPAAASSAAAKPATPQAQGGYPLRYVLDQFSDSNLYRLTVMVGSQSLT
RAYLAQNNTMVPAGAWVRKE
 
Nucleotide Sequence: 483 bp     [Download]
>gi|53793901|ref|NC_006352.1|:21029-21511 Uncultured bacterium activated sludge plasmid pTB11, complete sequence
ATGCGTAAGATTCTGACCGTCATCGCACTCGCGGCCACGTTGGCCGGCTGCGCGACCTCCAAGTACGGCA
GCTTCGTCCAGGACGCGCCGGCCGCCTACAACCAGACCATTGCGACCGACGCGGTGAAGCAGCTCGTCAA
GCTCTACCCGCCGGCGCAAACCAAGCTGGAATTGCAGCAGGCTACGCCCGATCCGTTCGGCATTGCCCTG
GTCACTGACCTTCGCGCCCAGGGCTATGCTGTCATGGAGTACAAGCCCGACGGCAACGCGGCCGCAGCTC
CGGCTGCTGCGTCCTCGGCCGCTGCGAAGCCGGCAACGCCGCAAGCCCAGGGCGGCTATCCGCTGCGCTA
CGTGCTGGACCAATTCAGCGACAGCAACCTGTATCGCCTGACCGTCATGGTCGGCTCTCAATCGCTCACG
CGCGCCTACCTCGCCCAAAACAACACGATGGTCCCGGCCGGCGCATGGGTTCGGAAGGAGTAA
 Primer design