SecReT4
Protein ID: 53793923
T4SS name [ID]Trb [48]
Gene symboltrbI
Locus tagpTB11p22
Strainuncultured bacterium plasmid pTB11 (NC_006352)
Repliconplasmid pTB11 [GenBank: NC_006352] [Browse all T4SS(s) in this replicon]
Location [Strand]21516..22907 [+]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDQ5ZHH4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.1e-64, Aligned region: 268..454
Protein Sequence: 463 a.a.     [Download]
>gi|53793923|ref|YP_112376.1| conjugal transfer protein TrbI [uncultured bacterium]
MSEDQMAPDASPDAVKPKSGVRRVNNMPMYLIGGVLGIFLLVMALVAADRAAQQNQPGAAKAEKAGSTSM
FADEIAGKQQDGIIKAKPLEIPPEQTAQQPTTELTPAPAQGTTITVARPENLDQPPTPPQGARNEDLDRI
RMAKLQMLEEAIKAKTTVRIDAPRSQGSAGGGAPQGREETLARIQELRRQAENARATDPTAAYQAALAQA
RTMGGAAGGGGMGGSGAPTLVQTSNRSGGGAGYGSFDNRSEGDRWRLDSQPEAPATPYVLRAGFVVPATL
ISGINSDLPGQIMAQVSQSVYDTATGKHMLIPQGSRLVGSYSNDVAYGQKRVLVAWQRIIFPDGKAMDIG
AMPGGDSAGYAGFNDKVNNHYFRTFASAFLMSGVVAGISLSQDRGNSNSGYGRQDAGSAMSEALGQQLGQ
VTAQMIAKNLNIAPTLEIRPGYRFNVIVTKDMTFSKPYQAFDY
 
Nucleotide Sequence: 1392 bp     [Download]
>gi|53793901|ref|NC_006352.1|:21516-22907 Uncultured bacterium activated sludge plasmid pTB11, complete sequence
ATGAGCGAAGATCAAATGGCACCGGACGCATCGCCAGATGCGGTCAAGCCGAAAAGCGGGGTTCGCCGCG
TCAACAACATGCCGATGTACCTCATCGGCGGTGTGCTCGGCATCTTCCTGCTGGTGATGGCCCTGGTTGC
TGCGGATCGCGCTGCGCAGCAGAACCAGCCGGGAGCTGCGAAGGCTGAGAAGGCCGGCAGCACCAGCATG
TTTGCCGACGAAATTGCCGGCAAACAGCAGGACGGCATCATCAAGGCCAAGCCGCTGGAGATTCCGCCGG
AACAAACCGCCCAGCAACCGACGACGGAGCTGACGCCAGCCCCGGCGCAGGGAACGACTATCACGGTCGC
ACGGCCCGAGAACCTGGACCAGCCCCCGACGCCGCCGCAGGGTGCGCGCAACGAGGACCTGGACCGCATC
CGCATGGCGAAGTTGCAGATGCTGGAAGAGGCGATCAAGGCCAAGACGACGGTGCGCATCGACGCGCCGC
GCAGCCAGGGCAGCGCCGGCGGCGGTGCTCCGCAGGGCCGCGAGGAAACCCTTGCGCGCATCCAGGAGCT
GCGTCGGCAGGCTGAGAACGCCCGCGCCACCGATCCGACCGCCGCCTATCAGGCCGCGCTTGCGCAGGCT
CGCACGATGGGCGGCGCGGCAGGGGGTGGCGGTATGGGCGGCTCGGGTGCGCCGACCCTCGTGCAGACCT
CGAACCGCAGTGGTGGCGGCGCTGGCTATGGGTCGTTCGACAACCGCAGCGAGGGCGACCGTTGGCGGCT
CGACTCCCAGCCGGAAGCACCTGCAACGCCCTATGTGCTGCGCGCTGGCTTCGTCGTTCCGGCTACGCTT
ATCTCGGGCATCAACTCCGATCTGCCAGGCCAAATCATGGCCCAGGTATCGCAGTCGGTGTACGACACGG
CGACCGGCAAGCACATGCTCATCCCCCAAGGCTCGCGCCTGGTGGGCAGCTACTCGAACGATGTGGCCTA
CGGGCAGAAGCGCGTTCTGGTGGCATGGCAGCGCATCATCTTCCCCGACGGCAAGGCAATGGACATTGGG
GCCATGCCGGGCGGCGATAGCGCTGGGTATGCAGGCTTCAACGACAAGGTCAACAACCACTACTTCCGCA
CCTTCGCATCGGCATTCCTCATGTCGGGCGTCGTTGCGGGCATCAGCTTGAGTCAGGACCGTGGCAACAG
CAACAGCGGTTACGGACGACAAGACGCGGGTTCCGCGATGAGTGAAGCGTTGGGTCAACAGCTCGGCCAA
GTAACGGCGCAGATGATCGCCAAAAACTTGAATATCGCGCCGACGCTGGAAATCCGTCCGGGCTATCGCT
TCAACGTCATTGTCACGAAAGACATGACGTTTTCTAAGCCCTACCAGGCGTTTGACTATTAA
 Primer design