SecReT4
Protein ID: 53793924
T4SS name [ID]Trb [48]
Gene symboltrbJ
Locus tagpTB11p23
Strainuncultured bacterium plasmid pTB11 (NC_006352)
Repliconplasmid pTB11 [GenBank: NC_006352] [Browse all T4SS(s) in this replicon]
Location [Strand]22924..23700 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ5ZHH3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 258 a.a.     [Download]
>gi|53793924|ref|YP_112377.1| conjugal transfer protein TrbJ [uncultured bacterium]
MKKLAKNVLAAKVALVLALSVGTLAVTPAQAGIPVIDGTNLSQTTVTAIQQVAQVQKQIEEYRTQLQQYE
NMLQNTVAPAAYVWDQAQSTINGLMSAVDTLNYYKNQAGSIDAYLGKFKDVSYYKGSPCFSLSGCSESER
KAMEENRRLASESQKKANDALFRGLDQQQSNLKSDAATLEQLKGKATTAQGQLEALGYANQFASQQANQL
MQIRGLLLAQQNAIATQMQAQQDRQAQQDAAGAKLREGSYRASPSKTW
 
Nucleotide Sequence: 777 bp     [Download]
>gi|53793901|ref|NC_006352.1|:22924-23700 Uncultured bacterium activated sludge plasmid pTB11, complete sequence
ATGAAGAAGCTCGCTAAGAATGTTTTAGCCGCTAAAGTAGCTCTGGTGCTGGCCCTCTCGGTCGGCACCT
TGGCGGTCACGCCTGCGCAAGCGGGCATTCCGGTCATCGACGGCACCAACCTGTCACAAACCACTGTCAC
CGCGATTCAGCAGGTTGCGCAGGTCCAGAAGCAAATCGAGGAATACCGGACGCAGTTGCAGCAGTACGAA
AACATGCTGCAAAACACGGTGGCCCCGGCCGCCTACGTGTGGGACCAGGCGCAGTCCACCATCAACGGCC
TGATGAGCGCCGTTGATACCCTGAACTACTACAAGAACCAGGCGGGCAGCATCGACGCTTACCTGGGCAA
GTTCAAGGACGTGTCCTACTACAAGGGGTCGCCGTGCTTCTCCCTGTCGGGCTGCTCGGAAAGCGAGCGC
AAGGCGATGGAAGAGAACCGCCGCCTGGCGTCCGAATCGCAGAAAAAGGCCAACGATGCGCTGTTCCGTG
GCCTCGATCAGCAGCAGAGCAACCTCAAGTCCGACGCCGCCACGCTGGAGCAATTGAAGGGCAAGGCGAC
GACGGCGCAGGGCCAGTTGGAAGCCCTCGGCTACGCCAACCAGTTCGCCAGCCAGCAGGCCAACCAGCTC
ATGCAAATCCGTGGCCTTCTGCTTGCGCAGCAGAACGCCATCGCCACGCAGATGCAGGCCCAGCAGGACC
GGCAGGCCCAGCAGGACGCTGCGGGCGCGAAGCTGCGCGAGGGTTCGTACCGCGCAAGCCCGTCTAAGAC
CTGGTGA
 Primer design