SecReT4
Protein ID: 53793925
T4SS name [ID]Trb [48]
Gene symboltrbK
Locus tagpTB11p24
Strainuncultured bacterium plasmid pTB11 (NC_006352)
Repliconplasmid pTB11 [GenBank: NC_006352] [Browse all T4SS(s) in this replicon]
Location [Strand]23712..23921 [+]
Productentry exclusion protein
Component typeTrbK
UniProt IDQ5ZHH2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 69 a.a.     [Download]
>gi|53793925|ref|YP_112378.1| entry exclusion protein [uncultured bacterium]
MKKSNFIAVAALAAVMAASLAGCDNKPDTDKLTCADLPKVTDAAQRAELLKKCPRGEPGGFKPSEKKEW
 
Nucleotide Sequence: 210 bp     [Download]
>gi|53793901|ref|NC_006352.1|:23712-23921 Uncultured bacterium activated sludge plasmid pTB11, complete sequence
ATGAAGAAATCCAACTTCATCGCAGTTGCCGCGCTGGCCGCCGTCATGGCGGCCAGCCTGGCAGGCTGCG
ACAACAAGCCCGACACCGACAAGCTGACCTGCGCCGATCTGCCGAAGGTCACGGATGCCGCTCAACGCGC
GGAGCTGTTGAAGAAGTGCCCGCGCGGAGAACCGGGAGGCTTCAAGCCCAGCGAAAAGAAAGAGTGGTGA
 Primer design