SecReT4
Protein ID: 53793926
T4SS name [ID]Trb [48]
Gene symboltrbL
Locus tagpTB11p25
Strainuncultured bacterium plasmid pTB11 (NC_006352)
Repliconplasmid pTB11 [GenBank: NC_006352] [Browse all T4SS(s) in this replicon]
Location [Strand]23928..25514 [+]
ProductTrbL protein
Component typeTrbL
UniProt IDQ5ZHH1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.2e-36, Aligned region: 63..276
Protein Sequence: 528 a.a.     [Download]
>gi|53793926|ref|YP_112379.1| TrbL protein [uncultured bacterium]
MKIQTRAAALAVLMLALMPVAAYAQIDNSGILDNVLQRYQNAASGWATVVQNAATWLFWTLTVISMVWTF
GMMALRKADIGEFFAEFVRFTIFTGFFWWLLTNGPNFASSIYASLRQIAGQATGLGQGLSPSGIVDVGFE
IFFKVMDETSYWSPVDSFVGASLAAAILCILALVGVNMLLLLASGWILAYGGVFFLGFGGSRWTSDMAIN
YYKTVLGVAAQLFAMVLLVGIGKTFLDDYYSRMSEGINFKELGVMLIVGLILLVLVNKVPQLIAGIITGA
SVGGAGIGQFGAGTLVGAAATAGAAIATGGASIAAGAAAAAGGAQAIMAAASKASDNVSAGTDILSSMMG
GGGGGGGGSAGTSGGDGGGSGGGGGSGGGETPMASAAGDNSSGARGGSSGGGSGGGRSSGGIGATAAKGG
RIAADTVANLAKGAGSIAKAKAGEMRASAQERIGDTVGGKIAQAIRGAGAAAQTAATVADSNSQAQEQPA
PAPAPSFDDNSLSASNNREAAADADSEVASFVNKPAQS
 
Nucleotide Sequence: 1587 bp     [Download]
>gi|53793901|ref|NC_006352.1|:23928-25514 Uncultured bacterium activated sludge plasmid pTB11, complete sequence
ATGAAAATCCAGACTAGAGCTGCCGCGCTCGCGGTCCTGATGCTGGCCTTGATGCCGGTAGCGGCATACG
CCCAAATCGACAATTCGGGCATCCTCGACAACGTATTGCAGCGCTACCAGAACGCCGCGAGCGGCTGGGC
CACTGTCGTCCAGAACGCCGCAACCTGGCTGTTCTGGACCTTGACCGTGATTAGCATGGTCTGGACCTTC
GGCATGATGGCACTGCGCAAGGCCGACATTGGCGAGTTCTTCGCCGAGTTCGTGCGGTTCACCATCTTCA
CCGGCTTCTTCTGGTGGCTGCTGACCAACGGCCCGAATTTCGCGTCGTCCATCTATGCGTCCCTGCGGCA
GATTGCAGGCCAGGCAACGGGGTTGGGGCAGGGGCTTTCGCCGTCCGGCATCGTCGATGTTGGCTTCGAG
ATTTTCTTCAAGGTGATGGACGAAACCTCGTACTGGTCGCCGGTCGATAGCTTCGTCGGTGCCTCGTTGG
CGGCCGCCATCCTCTGCATCCTGGCCCTGGTCGGCGTGAATATGCTTCTGCTCCTGGCGTCCGGATGGAT
TCTTGCCTACGGCGGTGTGTTCTTCCTGGGCTTCGGCGGCTCGCGCTGGACCTCGGACATGGCGATCAAC
TACTACAAGACCGTCCTCGGGGTCGCCGCGCAGCTCTTCGCAATGGTGCTGCTCGTAGGCATCGGCAAGA
CCTTCCTCGATGACTACTACAGCCGCATGAGCGAAGGCATCAACTTCAAGGAACTTGGAGTGATGCTGAT
CGTCGGCCTGATCCTGCTCGTTCTGGTCAACAAGGTGCCGCAGCTCATCGCCGGCATCATCACCGGCGCG
AGCGTCGGCGGTGCTGGTATCGGCCAGTTCGGCGCTGGCACGCTCGTCGGTGCGGCCGCGACGGCCGGCG
CGGCAATCGCAACTGGCGGCGCATCTATCGCGGCCGGCGCTGCGGCGGCGGCCGGTGGCGCGCAGGCCAT
CATGGCGGCCGCGTCGAAGGCCAGCGATAACGTCTCTGCCGGCACTGACATTCTGTCGAGCATGATGGGC
GGCGGCGGTGGCGGCGGCGGTGGTAGCGCCGGCACCAGCGGCGGCGACGGCGGCGGCTCGGGTGGCGGCG
GTGGCTCGGGCGGCGGTGAAACCCCGATGGCCTCGGCCGCCGGCGACAACAGCAGCGGCGCACGCGGCGG
CAGTTCGGGCGGCGGCTCGGGTGGTGGCCGTTCGTCTGGCGGTATCGGTGCCACGGCGGCCAAGGGCGGC
CGGATCGCGGCCGATACCGTCGCCAACCTGGCGAAAGGTGCCGGCTCGATTGCCAAGGCCAAGGCCGGCG
AAATGCGCGCATCGGCCCAGGAACGCATCGGCGATACCGTAGGCGGCAAGATCGCGCAGGCAATTCGCGG
CGCGGGTGCGGCGGCGCAGACCGCTGCAACCGTCGCCGATAGCAACAGCCAGGCGCAGGAACAACCTGCA
CCGGCACCCGCACCGTCGTTCGACGACAACAGCCTTTCCGCAAGCAACAACAGGGAAGCGGCCGCCGACG
CGGATTCCGAAGTGGCGAGCTTCGTCAACAAGCCCGCCCAATCCTGA
 Primer design