SecReT4
Protein ID: 53793928
T4SS name [ID]Trb [48]
Gene symboltrbN
Locus tagpTB11p27
Strainuncultured bacterium plasmid pTB11 (NC_006352)
Repliconplasmid pTB11 [GenBank: NC_006352] [Browse all T4SS(s) in this replicon]
Location [Strand]26153..26857 [+]
Productconjugal transfer protein TrbN
Component typeTrbN
UniProt IDQ5ZHG9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 234 a.a.     [Download]
>gi|53793928|ref|YP_112381.1| conjugal transfer protein TrbN [uncultured bacterium]
MPFAKLLARNALPVVALVAATGFGAADATAARLFPDLSEQMEERVVCSVSAAAKYEIPANILLAIREKEG
GKPGQWVKNTNGTYDVGELQFNTAYLGDLAKYGITAQDVAAAGCYPYDLAAWRLRGHIRNDRGDLWTRAA
NYHSRTPSKNAIYRADLMVKADKWAKWLDARFVTVNYGPSSPAQPAGKGTTLAAADTSAAAPAEAQPMKQ
GRITRTSLRSSGYVPRQLIINNTP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|53793901|ref|NC_006352.1|:26153-26857 Uncultured bacterium activated sludge plasmid pTB11, complete sequence
ATGCCGTTTGCCAAGCTGCTGGCACGGAACGCTCTGCCGGTGGTCGCCCTGGTGGCGGCCACTGGCTTCG
GTGCGGCGGATGCGACCGCCGCACGGCTCTTCCCCGATCTGTCGGAACAGATGGAAGAGCGCGTTGTGTG
CTCGGTGTCTGCGGCCGCGAAGTACGAGATTCCGGCCAACATTCTTCTCGCCATTCGGGAAAAGGAGGGC
GGCAAGCCGGGCCAGTGGGTCAAGAACACCAATGGCACCTATGACGTGGGCGAGCTGCAATTCAACACCG
CCTACCTGGGCGACCTGGCGAAGTATGGGATCACGGCCCAGGACGTTGCTGCGGCAGGCTGCTATCCCTA
TGACCTGGCGGCCTGGCGGTTGCGCGGGCACATTCGCAACGACAGGGGCGATCTGTGGACACGCGCCGCT
AACTATCACTCGCGCACGCCGTCGAAGAACGCGATCTATCGCGCCGATCTGATGGTGAAGGCCGACAAGT
GGGCGAAGTGGCTGGATGCGCGTTTCGTCACCGTCAACTATGGCCCCAGCTCGCCGGCGCAGCCGGCAGG
GAAGGGGACCACACTTGCGGCCGCTGATACGTCGGCAGCAGCGCCGGCCGAAGCGCAGCCGATGAAGCAA
GGCCGGATCACCCGCACCAGCCTCCGCAGCTCGGGTTACGTACCCCGGCAGCTCATCATCAACAACACGC
CATAA
 Primer design