SecReT4
Protein ID: 53793955
T4SS name [ID]Trb [48]
Gene symboltraF
Locus tagpTB11p54
Strainuncultured bacterium plasmid pTB11 (NC_006352)
Repliconplasmid pTB11 [GenBank: NC_006352] [Browse all T4SS(s) in this replicon]
Location [Strand]50317..50850 [-]
Productconjugal transfer peptidase TraF
Component typeTraF
UniProt IDQ5ZHE2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 3.5e-46, Aligned region: 31..176
Protein Sequence: 177 a.a.     [Download]
>gi|53793955|ref|YP_112408.1| conjugal transfer peptidase TraF [uncultured bacterium]
MSRFQRLTKYVAIGGGAALLLAGAAYLAGAKVNTTKSIPVGLYWKSNAPVEKGAYVMFCPPQVGVFSDAK
ERGYIAGGFCPGDYGYMMKRVLAAKGDEVAITDAGVRVNGGLLPHSALIKADPSGRPLPRYQSDSYTLGT
AEVLLMSDVSDTSFDGRYFGPVNRSQIITVIRPVLTW
 
Nucleotide Sequence: 534 bp     [Download]
>gi|53793901|ref|NC_006352.1|:c50850-50317 Uncultured bacterium activated sludge plasmid pTB11, complete sequence
ATGAGCCGCTTCCAGCGCCTCACCAAGTACGTCGCCATCGGAGGCGGCGCGGCCTTGTTGCTCGCCGGCG
CGGCCTATCTCGCCGGCGCGAAGGTCAACACCACCAAAAGCATTCCGGTCGGCCTGTACTGGAAATCGAA
TGCGCCGGTGGAGAAGGGGGCTTACGTCATGTTCTGCCCGCCGCAAGTCGGCGTGTTTTCGGACGCCAAG
GAGCGGGGCTACATCGCCGGCGGTTTCTGCCCCGGCGACTACGGCTACATGATGAAGCGAGTTTTAGCCG
CTAAAGGCGACGAGGTTGCCATCACCGACGCCGGCGTGCGCGTGAATGGCGGGCTGCTGCCTCACAGCGC
GCTCATCAAGGCCGATCCATCAGGACGGCCGCTGCCTCGTTATCAGTCCGACAGCTACACCCTGGGGACC
GCCGAGGTTCTGCTTATGTCCGACGTAAGCGACACGTCTTTCGACGGCCGCTACTTCGGGCCTGTCAATC
GTTCGCAAATCATCACCGTCATCAGGCCGGTTCTGACCTGGTGA
 Primer design