SecReT4
Protein ID: 53793956
T4SS name [ID]Trb [48]
Gene symboltraG
Locus tagpTB11p55
Strainuncultured bacterium plasmid pTB11 (NC_006352)
Repliconplasmid pTB11 [GenBank: NC_006352] [Browse all T4SS(s) in this replicon]
Location [Strand]50847..52754 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ5ZHE1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.6e-174, Aligned region: 120..621
TraG-D_C [PF12696], Evalue: 5.2e-32, Aligned region: 443..567
TrwB_AAD_bind [PF10412], Evalue: 1.8e-27, Aligned region: 175..567
Protein Sequence: 635 a.a.     [Download]
>gi|53793956|ref|YP_112409.1| conjugal transfer coupling protein TraG [uncultured bacterium]
MKNRNNAVGPQIRAKKPKASKTVPILAGLSLGAGLQTATQYFAHSFQYQAGLGWNINHVYTPWSILQWAG
KWYGQYPDDFMRAASMGMVVSTVGLLGTAVTQMVKANTGKANDYLHGSARWADKKDIQAAGLLPRPRTVV
ELVSGKHPPTSSGVYVGGWQDKDGKFHYLRHNGPEHVLTYAPTRSGKGVGLVVPTLLSWAHSAVITDLKG
ELWALTAGWRKKHARNKVVRFEPASAQGSACWNPLDEIRLGTEYEVGDVQNLATLIVDPDGKGLESHWQK
TSQALLVGVILHALYKAKNEGTPATLPSVDGMLADPNRDVGELWMEMTTYGHVDGQNHPAVGSAARDMMD
RPEEESGSVLSTAKSYLALYRDPVVARNVSKSDFRIKQLMHHDDPVSLFIVTQPNDKARLRPLVRVMVNM
IVRLLADKMDFENGRPVAHYKHRLLMMLDEFPSLGKLEILQESLAFVAGYGIKCYLICQDINQLKSRETG
YGHDESITSNCHVQNAYPPNRVETAEHLSKLTGTTTIVKEQITTSGRRTSALLGNVSRTFQEVQRPLLTP
DECLRMPGPKKSADGSIEEAGDMVVYVAGYPAIYGKQPLYFKDPIFQARAAVPAPKVSDKLIQTATVEEG
EGITI
 
Nucleotide Sequence: 1908 bp     [Download]
>gi|53793901|ref|NC_006352.1|:c52754-50847 Uncultured bacterium activated sludge plasmid pTB11, complete sequence
ATGAAGAACCGAAACAACGCCGTGGGGCCACAGATACGGGCGAAAAAACCGAAGGCCAGCAAGACCGTTC
CCATCCTCGCCGGCCTGTCCCTTGGGGCAGGCTTGCAGACCGCGACGCAATATTTCGCCCATTCCTTCCA
GTATCAGGCCGGACTTGGCTGGAATATCAACCACGTCTACACGCCCTGGTCGATCCTTCAATGGGCCGGC
AAGTGGTACGGCCAATATCCCGACGATTTCATGCGCGCGGCCAGCATGGGTATGGTCGTTTCGACCGTGG
GCCTGCTGGGCACGGCCGTCACGCAGATGGTCAAGGCGAACACCGGCAAGGCGAACGACTATCTGCACGG
TTCGGCCCGCTGGGCCGACAAGAAGGACATACAGGCCGCCGGCCTGCTGCCCCGGCCGCGCACCGTCGTC
GAGCTGGTGTCAGGCAAACACCCGCCCACTTCCAGCGGCGTCTATGTGGGCGGCTGGCAGGACAAGGACG
GCAAGTTCCACTACCTGCGGCACAACGGCCCCGAGCACGTCTTGACCTACGCGCCGACGCGCTCCGGCAA
GGGCGTCGGCCTGGTCGTTCCGACGCTGCTTTCCTGGGCGCACAGCGCCGTCATCACCGACCTGAAAGGC
GAGTTGTGGGCGCTGACCGCCGGCTGGCGGAAGAAGCATGCCCGCAACAAGGTCGTGCGCTTTGAGCCGG
CATCCGCGCAGGGTAGCGCGTGCTGGAACCCGCTCGATGAAATCCGCTTGGGGACCGAGTACGAGGTTGG
CGACGTGCAGAACCTTGCCACCCTGATCGTCGATCCGGACGGCAAGGGCCTGGAATCGCACTGGCAGAAA
ACCAGCCAGGCGCTGCTTGTCGGCGTCATCCTGCACGCGCTCTACAAGGCTAAGAACGAGGGTACGCCGG
CCACCCTGCCGTCGGTGGACGGCATGCTTGCCGACCCGAACCGCGACGTGGGCGAGCTTTGGATGGAAAT
GACCACCTACGGCCACGTTGACGGGCAGAACCACCCTGCGGTCGGCTCTGCGGCCCGCGACATGATGGAC
CGCCCGGAGGAAGAATCCGGTTCCGTGCTGTCCACCGCCAAGTCCTACCTGGCCCTGTACCGCGACCCGG
TTGTGGCCCGCAACGTCAGCAAGTCCGACTTCCGCATCAAGCAACTGATGCACCACGACGACCCGGTAAG
CCTGTTCATCGTGACGCAGCCCAACGACAAGGCCCGTCTGCGGCCTCTGGTGCGCGTCATGGTCAACATG
ATCGTCCGGCTGCTGGCCGACAAGATGGACTTCGAGAACGGCCGTCCTGTCGCGCACTACAAGCATCGTC
TGCTGATGATGCTCGACGAGTTCCCCAGCCTGGGCAAGCTCGAAATCCTGCAAGAGTCCCTTGCCTTCGT
CGCCGGCTACGGCATCAAGTGCTACCTCATCTGCCAGGACATTAACCAGCTCAAGAGCCGCGAAACCGGC
TACGGCCACGACGAAAGCATCACGTCGAACTGCCACGTGCAGAACGCCTACCCGCCGAACCGCGTGGAGA
CGGCCGAGCACCTGTCAAAACTGACAGGCACCACGACCATCGTGAAGGAGCAGATCACGACGAGCGGCCG
CCGCACGTCGGCGCTGTTGGGCAACGTCTCGCGGACCTTCCAGGAAGTGCAGCGGCCATTGCTGACCCCC
GATGAATGCCTGCGCATGCCGGGGCCGAAGAAGAGCGCCGACGGCAGCATTGAAGAGGCGGGCGACATGG
TTGTGTACGTCGCCGGCTATCCCGCGATCTACGGCAAGCAGCCGCTCTACTTCAAAGACCCGATATTCCA
GGCCCGCGCGGCCGTACCGGCTCCGAAGGTCAGCGACAAGCTGATCCAGACGGCCACCGTCGAGGAAGGG
GAGGGGATCACGATATGA
 Primer design