SecReT4
Protein ID: 54145489
T4SS name [ID]Tra_I [179]
Gene symboltrbB
Locus tagpCTX-M3_102
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]86248..87198 [-]
Producthypothetical protein
Component typeTrbB_I
UniProt IDQ8GFN8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Thioredoxin_2 [PF13098], Evalue: 1.2e-09, Aligned region: 179..297
TraF [PF13728], Evalue: 5.8e-06, Aligned region: 180..240
Thioredoxin [PF00085], Evalue: 1.7e-05, Aligned region: 168..213
DSBA [PF01323], Evalue: 1.9e-05, Aligned region: 184..213
Thioredoxin_4 [PF13462], Evalue: 3.5e-05, Aligned region: 181..236
Protein Sequence: 316 a.a.     [Download]
>gi|54145489|ref|NP_775061.2| hypothetical protein pCTX-M3_102 [Citrobacter freundii]
MKLTVKTDRNTLYLSADGSYQEQALHSFPLSACHFGLGHDAGSGHILTHNTFSGEAVQLFRFENEYQAIE
ALNNIRKKLKQQRGLNAVRRLSNFIFWPVAALGFIVSINGALMNMHQPAQPLQANSYAPAPGLQQPVTAP
EQLQVQAAPEAPKKLADNDLLSLKDAVTSGRFTISLSTGHKHTLYVFSDPMCPHCRALEPRLQELSKRYN
VEIFPVSVYGDLRSMVRAAPVLDTGKDTRLKSWEDTINMGYTTMNPKIDDPKTAPDTTGARLVEENNMAF
AKFGFIGTPSIVADSGDVIPVSVVKDDARLQQAIGE
 
Nucleotide Sequence: 951 bp     [Download]
>gi|54145488|ref|NC_004464.2|:c87198-86248 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGAAACTCACCGTAAAAACCGATCGCAACACACTTTATCTTTCCGCTGACGGAAGCTACCAGGAACAAG
CCCTGCACTCCTTCCCCCTGTCAGCCTGTCATTTTGGACTTGGCCATGATGCCGGCAGCGGCCACATCCT
GACGCACAATACGTTTTCTGGTGAAGCGGTGCAGCTGTTCCGCTTTGAAAACGAATATCAGGCCATCGAG
GCGCTGAACAATATCCGTAAAAAGCTGAAACAGCAGCGCGGACTCAATGCCGTGCGCCGGCTGTCTAACT
TTATCTTCTGGCCAGTCGCCGCGCTGGGCTTTATCGTCTCCATCAACGGCGCGTTGATGAATATGCATCA
GCCGGCACAGCCACTGCAGGCAAACTCGTATGCTCCCGCGCCGGGTCTGCAGCAGCCTGTCACTGCGCCG
GAGCAGCTGCAGGTTCAGGCAGCACCTGAAGCCCCTAAAAAACTGGCTGATAACGACTTGCTGTCACTGA
AAGATGCCGTCACCAGCGGACGCTTTACGATCTCGCTTTCAACCGGGCATAAACACACCCTGTATGTGTT
TTCCGATCCGATGTGCCCGCACTGCCGCGCGCTGGAACCCCGGCTGCAGGAACTGAGCAAACGCTATAAC
GTCGAGATTTTCCCCGTGTCCGTTTATGGCGACCTGCGCTCGATGGTCCGCGCCGCTCCTGTACTCGATA
CCGGGAAAGATACCCGACTGAAAAGCTGGGAAGACACGATTAACATGGGATACACCACCATGAACCCGAA
AATTGACGATCCGAAAACAGCCCCGGATACCACCGGCGCCCGCCTGGTTGAGGAGAACAATATGGCATTT
GCGAAATTCGGGTTTATCGGCACCCCGTCCATCGTTGCCGATTCGGGTGATGTGATCCCGGTTTCCGTCG
TCAAAGACGATGCCCGCCTGCAGCAGGCAATAGGAGAATAA
 Primer design