SecReT4
Protein ID: 54292922
T4SS name [ID]Tra_F [539]
Gene symbol-
Locus tagplpl0015
StrainLegionella pneumophila str. Lens
Repliconplasmid pLPL [GenBank: NC_006366] [Browse all T4SS(s) in this replicon]
Location [Strand]13634..13930 [+]
Producthypothetical protein
Component typeTraL_F
UniProt IDQ5WRZ2
KEGG IDlpf:plpl0015
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.1e-29, Aligned region: 5..97
Protein Sequence: 98 a.a.     [Download]
>gi|54292922|ref|YP_122309.1| hypothetical protein plpl0015 [Legionella pneumophila str. Lens]
MSNMNYQFLNHIDAPKRVLTLTMDELVVTALSFILLILSNQKVLVSMLGLGLLSGLRHLKKGEGPKVLLV
LAYWYLPSYITQFFLPKLPLSHHRVYVA
 
Nucleotide Sequence: 297 bp     [Download]
>gi|54292907|ref|NC_006366.1|:13634-13930 Legionella pneumophila str. Lens plasmid pLPL, complete sequence
ATGAGTAACATGAACTATCAATTCTTAAACCACATTGATGCGCCCAAGAGGGTCTTAACGCTAACCATGG
ATGAGCTGGTAGTGACGGCCTTAAGCTTTATCTTGCTCATCCTCTCCAATCAAAAAGTATTGGTATCAAT
GTTGGGATTGGGTTTGTTAAGTGGGTTGCGGCATTTGAAGAAAGGGGAGGGTCCAAAGGTGCTTTTAGTG
TTGGCTTATTGGTATTTACCCAGTTATATCACTCAGTTTTTTCTGCCCAAATTACCTTTATCACACCACC
GTGTGTATGTGGCTTAA
 Primer design