SecReT4
Protein ID: 54292932
T4SS name [ID]Tra_F [539]
Gene symbol-
Locus tagplpl0026
StrainLegionella pneumophila str. Lens
Repliconplasmid pLPL [GenBank: NC_006366] [Browse all T4SS(s) in this replicon]
Location [Strand]23503..24243 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDQ5WRY2
KEGG IDlpf:plpl0026
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.5e-64, Aligned region: 23..235
Protein Sequence: 246 a.a.     [Download]
>gi|54292932|ref|YP_122319.1| conjugal pilus assembly protein TraF [Legionella pneumophila str. Lens]
MINRMLIVFLLLSGVAFADKPVGFLWYTKERETKRVEKKTSGIPFKSLSYTERDAVLRFYTMEALHKARY
TKKMEDMRVFLSLQDYWLKESSRFKSLFQKTMLAHPEYDYAVTHPTSNLGAKITDEVRESQTIEVINRLS
KSHGLLFFYRGKSPYDLKQIPIIVDFCKRFRIQLIPVSVDGATSPELLNSRMDQGQANRLGVRYFPALLL
VNPASQQVSPVAYGLTTQDVLMERIKQVVNQFKGEE
 
Nucleotide Sequence: 741 bp     [Download]
>gi|54292907|ref|NC_006366.1|:23503-24243 Legionella pneumophila str. Lens plasmid pLPL, complete sequence
ATGATTAATAGGATGCTAATTGTTTTTTTGCTACTTAGTGGGGTTGCGTTTGCTGATAAACCGGTGGGTT
TTCTATGGTATACAAAAGAAAGGGAAACAAAAAGAGTCGAGAAAAAAACCTCGGGTATTCCTTTTAAGAG
TCTAAGCTATACAGAGCGCGATGCTGTTCTGCGCTTCTACACCATGGAAGCGCTTCATAAAGCACGGTAC
ACCAAAAAGATGGAGGACATGCGCGTATTTTTAAGTCTGCAAGATTACTGGCTTAAAGAGTCCTCCCGAT
TTAAGTCATTGTTTCAGAAAACGATGTTGGCACATCCAGAATATGATTATGCAGTGACTCATCCGACTTC
TAATCTGGGCGCAAAAATCACCGATGAGGTGCGCGAATCCCAAACCATAGAAGTTATAAACCGCTTGTCC
AAATCACATGGCTTGTTGTTTTTTTATCGTGGAAAAAGCCCTTATGACTTAAAGCAAATACCCATTATTG
TTGATTTTTGCAAGCGATTTCGCATTCAACTGATCCCAGTTAGTGTTGATGGCGCAACCTCTCCCGAACT
GCTGAATTCTCGAATGGATCAAGGGCAAGCTAATCGATTGGGTGTTCGTTATTTTCCAGCACTGCTGTTG
GTGAATCCTGCAAGCCAACAGGTTTCACCTGTGGCATATGGCTTAACTACGCAGGATGTCTTGATGGAAC
GTATAAAACAAGTGGTCAACCAATTTAAAGGAGAGGAATAA
 Primer design